VPS33A Antibody - Azide and BSA Free

Western Blot: VPS33A Antibody [H00065082-B01P] - Analysis of VPS33A expression in human pancreas.

Western Blot: VPS33A Antibody [H00065082-B01P] - Analysis of VPS33A expression in HepG2.

Western Blot: VPS33A Antibody [H00065082-B01P] - Analysis of VPS33A expression in transfected 293T cell line by VPS33A polyclonal antibody. Lane 1: VPS33A transfected lysate(65.56 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

VPS33A Antibody - Azide and BSA Free Summary

• Immunogen: VPS33A (NP_075067.2, 1 a.a. - 596 a.a.) full-length human protein. MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: VPS33A
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is useful for Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VPS33A Antibody - Azide and BSA Free

• FLJ22395
• FLJ23187
• hVPS33A
• vacuolar protein sorting 33 homolog A (S. cerevisiae)
• vacuolar protein sorting 33A (yeast)
• vacuolar protein sorting 33A
• vacuolar protein sorting-associated protein 33A

Background

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene is a member of the Sec-1 domain family, and it encodes a protein similar to the yeast class C Vps33 protein. The mammalian class C VPS proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: VPS33A
• Uniprot:
  • NP_075067.2(Human)