Recombinant Human VPS18 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human VPS18 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 3-100 of Human VPS18 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
VPS18

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VPS18 Protein

  • hVPS18
  • KIAA1475PEP3
  • vacuolar protein sorting 18 homolog (S. cerevisiae)
  • vacuolar protein sorting protein 18
  • vacuolar protein sorting-associated protein 18 homolog

Background

VPS18 - vacuolar protein sorting protein 18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2412
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-48785
Species: Hu
Applications: WB, IHC
NBP2-44235
Species: Ce, Pl
Applications: WB, ELISA, IHC
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP1-86731
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1448
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-81639
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76535
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15078
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023355-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-57242
Species: Hu
Applications: WB, ICC/IF

Publications for VPS18 Partial Recombinant Protein (H00057617-Q01) (0)

There are no publications for VPS18 Partial Recombinant Protein (H00057617-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS18 Partial Recombinant Protein (H00057617-Q01) (0)

There are no reviews for VPS18 Partial Recombinant Protein (H00057617-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS18 Partial Recombinant Protein (H00057617-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VPS18 Products

Bioinformatics Tool for VPS18 Partial Recombinant Protein (H00057617-Q01)

Discover related pathways, diseases and genes to VPS18 Partial Recombinant Protein (H00057617-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS18 Partial Recombinant Protein (H00057617-Q01)

Discover more about diseases related to VPS18 Partial Recombinant Protein (H00057617-Q01).
 

Pathways for VPS18 Partial Recombinant Protein (H00057617-Q01)

View related products by pathway.

PTMs for VPS18 Partial Recombinant Protein (H00057617-Q01)

Learn more about PTMs related to VPS18 Partial Recombinant Protein (H00057617-Q01).
 

Research Areas for VPS18 Partial Recombinant Protein (H00057617-Q01)

Find related products by research area.

Blogs on VPS18

There are no specific blogs for VPS18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VPS18 Antibody
NBP1-82906

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VPS18 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS18