Recombinant Human VCX3A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human VCX3A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-166 of Human VCX3A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEELPSM

Protein/Peptide Type
Recombinant Protein
Gene
VCX3A

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VCX3A Protein

  • Variable charge protein on X with eight repeats
  • variable charge X-linked protein 3
  • variable charge, X-linked 3A
  • Variably charged protein X-A
  • variably charged X-A
  • VCX3
  • VCX-8R
  • VCX8RMGC125730
  • VCX-8rvariable charge, X-linked 3
  • VCX-AMGC118976
  • VCXAMGC125796

Background

This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-46770
Species: Hu
Applications: IHC, IHC-P
NBP1-62667
Species: Hu
Applications: WB
AF5158
Species: Hu
Applications: WB, IHC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76580
Species: Hu
Applications: WB, ELISA, ICC/IF, ICC
NBP2-55181
Species: Hu
Applications: ICC/IF
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
H00027130-P02
Species: Hu
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for VCX3A Recombinant Protein (H00051481-P01) (0)

There are no publications for VCX3A Recombinant Protein (H00051481-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VCX3A Recombinant Protein (H00051481-P01) (0)

There are no reviews for VCX3A Recombinant Protein (H00051481-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VCX3A Recombinant Protein (H00051481-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VCX3A Products

Bioinformatics Tool for VCX3A Recombinant Protein (H00051481-P01)

Discover related pathways, diseases and genes to VCX3A Recombinant Protein (H00051481-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VCX3A Recombinant Protein (H00051481-P01)

Discover more about diseases related to VCX3A Recombinant Protein (H00051481-P01).

Research Areas for VCX3A Recombinant Protein (H00051481-P01)

Find related products by research area.

Blogs on VCX3A

There are no specific blogs for VCX3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VCX3A Antibody
H00051481-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VCX3A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VCX3A