We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human VCX3A GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human VCX3A GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-166 of Human VCX3A

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEELPSM

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
VCX3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
44.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VCX3A GST (N-Term) Protein

  • Variable charge protein on X with eight repeats
  • variable charge X-linked protein 3
  • variable charge, X-linked 3A
  • Variably charged protein X-A
  • variably charged X-A
  • VCX3
  • VCX-8R
  • VCX8RMGC125730
  • VCX-8rvariable charge, X-linked 3
  • VCX-AMGC118976
  • VCXAMGC125796

Background

This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC,  IHC-P
NBP2-46770
Species: Hu
Applications: IHC,  IHC-P
NBP2-56601
Species: Hu
Applications: ICC/IF
AF5158
Species: Hu
Applications: IHC, WB
NBP1-90095
Species: Hu
Applications: IHC,  IHC-P
NBP1-52105
Species: Hu, Rt
Applications: Flow, IHC,  IHC-P, PEP-ELISA, WB
NBP3-46613
Species: Hu, Mu, Rt, Ze
Applications: ELISA, ICC/IF, IHC, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-13754
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-03937
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP3-15753
Species: Hu, Mu, Rt
Applications: WB
NBP2-20237
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-87691
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-46466
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB

Publications for VCX3A Recombinant Protein (H00051481-P01) (0)

There are no publications for VCX3A Recombinant Protein (H00051481-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VCX3A Recombinant Protein (H00051481-P01) (0)

There are no reviews for VCX3A Recombinant Protein (H00051481-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VCX3A Recombinant Protein (H00051481-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VCX3A Products

Research Areas for VCX3A Recombinant Protein (H00051481-P01)

Find related products by research area.

Blogs on VCX3A

There are no specific blogs for VCX3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VCX3A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VCX3A