Recombinant Human VCX3A GST (N-Term) Protein Summary
| Description |
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-166 of Human VCX3A Source: Wheat Germ (in vitro) Amino Acid Sequence: MSPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSQESEVEEPLSQESQVEEPLSQESEVEEPLSQESQVEEPLSQESEMEELPSM |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
VCX3A |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Theoretical MW |
44.2 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human VCX3A GST (N-Term) Protein
Background
This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: Flow, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt, Ze
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for VCX3A Recombinant Protein (H00051481-P01) (0)
There are no publications for VCX3A Recombinant Protein (H00051481-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VCX3A Recombinant Protein (H00051481-P01) (0)
There are no reviews for VCX3A Recombinant Protein (H00051481-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VCX3A Recombinant Protein (H00051481-P01) (0)
Additional VCX3A Products
Research Areas for VCX3A Recombinant Protein (H00051481-P01)
Find related products by research area.
|
Blogs on VCX3A