Recombinant Human USP29 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human USP29 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 131-240 of Human USP29 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KTSFYSICNKPSYQKMPLFMSKSPTHVKKGILENQGGKGQNTLSSDVQTNEDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
USP29

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human USP29 Protein

  • Deubiquitinating enzyme 29
  • EC 3.1.2.15
  • EC 3.4.19.12
  • HOM-TES-84/86
  • MGC163266
  • MGC163270
  • ubiquitin carboxyl-terminal hydrolase 29
  • ubiquitin specific peptidase 29
  • ubiquitin specific protease 29
  • ubiquitin thioesterase 29
  • Ubiquitin thiolesterase 29
  • ubiquitin-specific processing protease
  • Ubiquitin-specific-processing protease 29
  • USP29

Background

USP29 - ubiquitin specific protease 29

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-88117
Species: Hu
Applications: WB (-), WB, IHC, IHC-P, IP
NBP2-47279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00009960-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6008
Species: Hu, Mu, Rt
Applications: WB
NBP1-80589
Species: Hu
Applications: IHC, IHC-P
NB500-240
Species: Hu, Mu
Applications: WB, IP
NBP2-46288
Species: Hu
Applications: IHC
NBP2-16543
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-513
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-80298
Species: Hu
Applications: WB, IHC
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7735
Species: Hu
Applications: WB
H00009097-M04
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for USP29 Partial Recombinant Protein (H00057663-Q01) (0)

There are no publications for USP29 Partial Recombinant Protein (H00057663-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP29 Partial Recombinant Protein (H00057663-Q01) (0)

There are no reviews for USP29 Partial Recombinant Protein (H00057663-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP29 Partial Recombinant Protein (H00057663-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP29 Products

Bioinformatics Tool for USP29 Partial Recombinant Protein (H00057663-Q01)

Discover related pathways, diseases and genes to USP29 Partial Recombinant Protein (H00057663-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP29 Partial Recombinant Protein (H00057663-Q01)

Discover more about diseases related to USP29 Partial Recombinant Protein (H00057663-Q01).
 

Pathways for USP29 Partial Recombinant Protein (H00057663-Q01)

View related products by pathway.

PTMs for USP29 Partial Recombinant Protein (H00057663-Q01)

Learn more about PTMs related to USP29 Partial Recombinant Protein (H00057663-Q01).

Blogs on USP29

There are no specific blogs for USP29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

USP29 Antibody
NBP1-86425
USP7 Antibody
NB100-513

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human USP29 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol USP29
Entrez