USP22 Antibody

Product Discontinued

USP22 Antibody Summary

• Immunogen: Synthetic peptides corresponding to USP22(ubiquitin specific peptidase 22) The peptide sequence was selected from the middle region of USP22. Peptide sequence PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE.
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (93%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP22
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against USP22 and was validated on Western blot.
• Theoretical MW: 60 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for USP22 Antibody

• Deubiquitinating enzyme 22
• EC 3.1.2.15
• EC 3.4.19.12
• KIAA1063ubiquitin carboxyl-terminal hydrolase 22
• KIAA1064
• ubiquitin specific peptidase 22
• ubiquitin specific peptidase 3-like
• ubiquitin specific protease 22
• Ubiquitin Thioesterase 22
• Ubiquitin thiolesterase 22
• ubiquitin-specific processing protease 22
• Ubiquitin-specific-processing protease 22
• USP22
• USP3L

Background

USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP22
• Uniprot:
  • Q9UPT9()