UGT2B15 Antibody

Images

 
Western Blot: UGT2B15 Antibody [H00007366-B01P] - Analysis of UGT2B15 expression in human liver.
Western Blot: UGT2B15 Antibody [H00007366-B01P] - Analysis of UGT2B15 expression in A-431.
Western Blot: UGT2B15 Antibody [H00007366-B01P] - Analysis of UGT2B15 expression in transfected 293T cell line by UGT2B15 polyclonal antibody. Lane 1: UGT2B15 transfected lysate(58.3 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UGT2B15 Antibody Summary

Immunogen
UGT2B15 (AAI46571.1, 1 a.a. - 530 a.a.) full-length human protein. MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD
Specificity
Reacts with UDP glucuronosyltransferase 2 family, polypeptide B15.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
UGT2B15
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UGT2B15 Antibody

  • EC 2.4.1
  • EC 2.4.1.17
  • HLUG4
  • UDP glucuronosyltransferase 2 family, polypeptide B15
  • UDP glycosyltransferase 2 family, polypeptide B15
  • UDP glycosyltransferase 2B15
  • UDP-glucuronosyltransferase 2B15
  • UDP-glucuronosyltransferase 2B8
  • UDP-glucuronosyltransferase UGT2B15
  • UDP-glucuronyltransferase, family 2, beta-15
  • UDPGT 2B15
  • UDPGT 2B8
  • UDPGTH3
  • UDPGTh-3
  • UGT2B8UDPGT2B15

Background

The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. See UGT2B4 (MIM 600067).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
AF6490
Species: Hu
Applications: WB, IHC, ICC
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00054659-M02
Species: Hu
Applications: WB, ELISA
H00007363-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-69412
Species: Hu
Applications: WB
NBP1-72063
Species: Rt
Applications: WB, PEP-ELISA
NBP2-06724
Species: Hu
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-08443
Species: Hu
NBP1-59786
Species: Hu
Applications: WB
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007366-B01P
Species: Hu
Applications: WB

Publications for UGT2B15 Antibody (H00007366-B01P) (0)

There are no publications for UGT2B15 Antibody (H00007366-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT2B15 Antibody (H00007366-B01P) (0)

There are no reviews for UGT2B15 Antibody (H00007366-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGT2B15 Antibody (H00007366-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UGT2B15 Products

Bioinformatics Tool for UGT2B15 Antibody (H00007366-B01P)

Discover related pathways, diseases and genes to UGT2B15 Antibody (H00007366-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT2B15 Antibody (H00007366-B01P)

Discover more about diseases related to UGT2B15 Antibody (H00007366-B01P).
 

Pathways for UGT2B15 Antibody (H00007366-B01P)

View related products by pathway.

PTMs for UGT2B15 Antibody (H00007366-B01P)

Learn more about PTMs related to UGT2B15 Antibody (H00007366-B01P).

Blogs on UGT2B15

There are no specific blogs for UGT2B15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGT2B15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT2B15
Entrez
Uniprot