UBTFL1 Antibody

Images

 
Western Blot: UBTFL1 Antibody [NBP1-91405] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBTFL1 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human LOC642623. Peptide sequence ELVLEAKKCVKKMNKSQKYRNGPDFPKRPLTAYNRFFKESWPQYSQMYPG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBTFL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against LOC642623 and was validated on Western blot.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UBTFL1 Antibody

  • C11orf27
  • HMGPI
  • putative upstream-binding factor 1-like protein 1
  • upstream binding transcription factor, RNA polymerase I-like 1
  • upstream-binding factor 1-like protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00388112-B01P
Species: Hu
Applications: WB
AF1997
Species: Hu
Applications: WB, ChIP, ICC
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NB100-2136
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP2-80439
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-91405
Species: Hu
Applications: WB

Publications for UBTFL1 Antibody (NBP1-91405) (0)

There are no publications for UBTFL1 Antibody (NBP1-91405).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBTFL1 Antibody (NBP1-91405) (0)

There are no reviews for UBTFL1 Antibody (NBP1-91405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBTFL1 Antibody (NBP1-91405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UBTFL1 Products

Array NBP1-91405

Bioinformatics Tool for UBTFL1 Antibody (NBP1-91405)

Discover related pathways, diseases and genes to UBTFL1 Antibody (NBP1-91405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UBTFL1

There are no specific blogs for UBTFL1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBTFL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBTFL1
Uniprot