UBE2O Antibody

Images

 
Western Blot: UBE2O Antibody [NBP2-13501] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: UBE2O Antibody [NBP2-13501] - Staining of human cell line A549 shows localization to nuclear bodies.
Immunohistochemistry-Paraffin: UBE2O Antibody [NBP2-13501] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Western Blot: UBE2O Antibody [NBP2-13501] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-618

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UBE2O Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIG TNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGAR CSMNTEDGAKLYDVCPHVSDSGLFF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2O
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
UBE2O Protein (NBP2-13501PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for UBE2O Antibody

  • E2-230K
  • EC 6.3.2.19
  • FLJ12878
  • KIAA1734
  • Ubiquitin carrier protein O
  • ubiquitin-conjugating enzyme E2 O
  • Ubiquitin-conjugating enzyme E2 of 230 kDa
  • Ubiquitin-conjugating enzyme E2-230K
  • ubiquitin-conjugating enzyme E2O
  • Ubiquitin-protein ligase O

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

A-605
Species: Hu
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
E2-695
Species: Hu

Publications for UBE2O Antibody (NBP2-13501) (0)

There are no publications for UBE2O Antibody (NBP2-13501).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2O Antibody (NBP2-13501) (0)

There are no reviews for UBE2O Antibody (NBP2-13501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for UBE2O Antibody (NBP2-13501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE2O Products

Bioinformatics Tool for UBE2O Antibody (NBP2-13501)

Discover related pathways, diseases and genes to UBE2O Antibody (NBP2-13501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UBE2O

There are no specific blogs for UBE2O, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2O Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2O