UAP1L1 Antibody

Images

 
Western Blot: UAP1L1 Antibody [NBP1-74151] - Mouse Pancreas Lysate 1.0 ug/ml, gel concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UAP1L1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of UAP1L1 Immunizing peptide sequence KVPYVDEEGNLVKPLRPNGIKMEKFVFDVFQFAKNFVAFEVCREEEFSPL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UAP1L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against UAP1L1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UAP1L1 Antibody

  • EC 2.7.7
  • EC 2.7.7.-
  • EC 2.7.7.23
  • EC 2.7.7.27
  • RP11-229P13.18
  • UDP-N-acetylhexosamine pyrophosphorylase-like protein 1
  • UDP-N-acteylglucosamine pyrophosphorylase 1-like 1

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-07799
Species: Hu
NBP1-89289
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
1169-FR/CF
Species: Mu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31025
Species: Hu
Applications: IHC, IHC-P
AF1734
Species: Hu
Applications: WB, IP

Publications for UAP1L1 Antibody (NBP1-74151) (0)

There are no publications for UAP1L1 Antibody (NBP1-74151).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UAP1L1 Antibody (NBP1-74151) (0)

There are no reviews for UAP1L1 Antibody (NBP1-74151). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UAP1L1 Antibody (NBP1-74151) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UAP1L1 Products

UAP1L1 NBP1-74151

Bioinformatics Tool for UAP1L1 Antibody (NBP1-74151)

Discover related pathways, diseases and genes to UAP1L1 Antibody (NBP1-74151). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UAP1L1 Antibody (NBP1-74151)

Discover more about diseases related to UAP1L1 Antibody (NBP1-74151).
 

Pathways for UAP1L1 Antibody (NBP1-74151)

View related products by pathway.

PTMs for UAP1L1 Antibody (NBP1-74151)

Learn more about PTMs related to UAP1L1 Antibody (NBP1-74151).

Blogs on UAP1L1

There are no specific blogs for UAP1L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UAP1L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UAP1L1
Uniprot