Recombinant Human TXNDC Protein

Images

 
SDS-Page: Recombinant Human TXNDC Protein [H00081542-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TXNDC Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-280 of Human TXNDC full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPSGSLAVPLAVMVPLLWGAPWTHGRRSNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYFIEDLGLPVWGSYTVFALATLFSGLLLGLCMIFVADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS

Protein/Peptide Type
Recombinant Protein
Gene
TMX1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TXNDC Protein

  • DKFZp564E1962
  • PDIA11
  • protein disulfide isomerase family A, member 11
  • thioredoxin domain containing 1
  • Thioredoxin domain-containing protein 1
  • thioredoxin domain-containing
  • thioredoxin-related transmembrane protein 1
  • TMXTXNDC
  • Transmembrane Trx-related protein
  • TXNDC1thioredoxin domain containing

Background

TXNDC1 is a thioredoxin (TXN; see MIM 187700)-related protein with disulfide reductase activity (Matsuo et al., 2001 [PubMed 11152479]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20183
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-85158
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
H00081542-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TXNDC Recombinant Protein (H00081542-P01) (0)

There are no publications for TXNDC Recombinant Protein (H00081542-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TXNDC Recombinant Protein (H00081542-P01) (0)

There are no reviews for TXNDC Recombinant Protein (H00081542-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TXNDC Recombinant Protein (H00081542-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TXNDC Products

Bioinformatics Tool for TXNDC Recombinant Protein (H00081542-P01)

Discover related pathways, diseases and genes to TXNDC Recombinant Protein (H00081542-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TXNDC Recombinant Protein (H00081542-P01)

Discover more about diseases related to TXNDC Recombinant Protein (H00081542-P01).
 

Pathways for TXNDC Recombinant Protein (H00081542-P01)

View related products by pathway.

PTMs for TXNDC Recombinant Protein (H00081542-P01)

Learn more about PTMs related to TXNDC Recombinant Protein (H00081542-P01).
 

Research Areas for TXNDC Recombinant Protein (H00081542-P01)

Find related products by research area.

Blogs on TXNDC

There are no specific blogs for TXNDC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TXNDC Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TMX1