TWF2 Antibody - BSA Free

Images

 
Western Blot: TWF2 Antibody [NBP2-88525] - Host: Rabbit. Target Name: TWF2. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Product Discontinued
View other related TWF2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-88525
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TWF2 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit TWF2 Antibody - BSA Free (NBP2-88525) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human TWF2. Peptide sequence: KKIEIGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TWF2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for TWF2 Antibody - BSA Free

  • A6-related protein
  • A6RPFLJ56277
  • hA6RP
  • protein tyrosine kinase 9-like (A6-related protein)
  • Protein tyrosine kinase 9-like
  • PTK9L protein tyrosine kinase 9-like (A6-related protein)
  • PTK9LA6r
  • twinfilin, actin-binding protein, homolog 2 (Drosophila)
  • Twinfilin-1-like protein
  • twinfilin-2

Background

TWF2, also known as Twinfilin-2, is a 349 amino acid protein that is 40 kDa, ubiquitously expressed at protein level, involved in motile and morphological processes, inhibits actin polymerization by sequestering G-actin, and regulates motility by capping the barbed ends. It seems to play an important role in clathrin-mediated endocytosis and distribution of endocytic organelles and participates in regulating the mature length of the middle and short rows of stereocilia. Current research is being performed on several diseases and disorders including monkeypox, cowpox, smallpox, vaccinia, meningioma, leukemia, and neuronitis. The TWF2 protein has shown an interaction with ARHGDIA, ACTR3B, CHGB, CAPZA1, and CAPZA2 in positive regulation of lamellipodium assembly, positive regulation of neuron projection development, cell projection organization, negative regulation of actin filament polymerization, and regulation of microvillus length pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90297
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF3966
Species: Hu
Applications: IHC, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-49118
Species: Hu
Applications: IHC,  IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
236-EG
Species: Hu
Applications: BA
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-00527
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for TWF2 Antibody (NBP2-88525) (0)

There are no publications for TWF2 Antibody (NBP2-88525).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TWF2 Antibody (NBP2-88525) (0)

There are no reviews for TWF2 Antibody (NBP2-88525). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TWF2 Antibody (NBP2-88525) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TWF2 Products

Research Areas for TWF2 Antibody (NBP2-88525)

Find related products by research area.

Blogs on TWF2

There are no specific blogs for TWF2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TWF2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol TWF2