| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 7B7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | TULP4 (NP_001007467.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGNGRGVVGVTFTSSHCRRDRSTPQRINFNLRGHNSEVVLVRWNEPYQKLAT |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TULP4 |
| Purity | Protein A or G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A or G purified |
Secondary Antibodies |
Isotype Controls |
|
Can Tubby Make You Tubby? The TUB gene, which encodes for the protein Tubby, is evolutionarily conserved in human, chimpanzee, dog, cow, mouse, chicken, zebrafish, fruit fly, mosquito, C. elegans, and rice. The gene derives its name from its role in metabolism; mice with a m... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TULP4 |
| Entrez |
|
| Uniprot |
|