TUFM Antibody (CL2245)

Images

 
Western Blot: TUFM Antibody (CL2245) [NBP2-36753] - Lane 1: Marker [kDa]. Lane 2: Human cell line U-251 MG
Immunocytochemistry/ Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining in U251 cell line showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red ...read more
Immunohistochemistry-Paraffin: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular epithelium cells.
Immunocytochemistry/ Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining in HeLa cell line showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red ...read more
Immunocytochemistry/ Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human cell line A431 showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized ...read more
Immunocytochemistry/ Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining in MCF7 cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule-staining and ...read more
Immunocytochemistry/ Immunofluorescence: TUFM Antibody (CL2245) [NBP2-36753] - Staining in U2OS cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule-staining and ...read more
Immunohistochemistry-Paraffin: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human skin shows granular cytoplasmic immunoreactivity in epithelial cells.
Immunohistochemistry-Paraffin: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human placenta shows strong cytoplasmic positivity in trophoblast.
Immunohistochemistry-Paraffin: TUFM Antibody (CL2245) [NBP2-36753] - Staining of human kidney shows granular cytoplasmic immunoreactivity in renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clone
CL2245
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TUFM Antibody (CL2245) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSI
Epitope
PFLLPVEAVYSVPGR
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
TUFM
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for TUFM Antibody (CL2245)

  • EFTu
  • EF-Tu
  • EFTUCOXPD4
  • EF-TuMT
  • elongation factor Tu, mitochondrial
  • P43
  • Tu translation elongation factor, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75478
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-22439
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-02710
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-34390
Species: Hu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-94504
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-38780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-82857
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00009669-B01P
Species: Hu
Applications: ICC/IF, WB
H00026156-B01P
Species: Hu
Applications: ICC/IF, WB
H00028299-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-2269
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP2-36753
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TUFM Antibody (NBP2-36753) (0)

There are no publications for TUFM Antibody (NBP2-36753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TUFM Antibody (NBP2-36753) (0)

There are no reviews for TUFM Antibody (NBP2-36753). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TUFM Antibody (NBP2-36753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TUFM Products

Bioinformatics Tool for TUFM Antibody (NBP2-36753)

Discover related pathways, diseases and genes to TUFM Antibody (NBP2-36753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TUFM Antibody (NBP2-36753)

Discover more about diseases related to TUFM Antibody (NBP2-36753).
 

Pathways for TUFM Antibody (NBP2-36753)

View related products by pathway.

PTMs for TUFM Antibody (NBP2-36753)

Learn more about PTMs related to TUFM Antibody (NBP2-36753).

Blogs on TUFM

There are no specific blogs for TUFM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TUFM Antibody (CL2245) and receive a gift card or discount.

Bioinformatics

Gene Symbol TUFM
Uniprot