TTYH3 Antibody


Immunohistochemistry-Paraffin: TTYH3 Antibody [NBP2-30621] - Staining of human salivary gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

TTYH3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQ
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TTYH3 Protein (NBP2-30621PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TTYH3 Antibody

  • hTTY3
  • KIAA1691
  • protein tweety homolog 3
  • tweety homolog 3 (Drosophila)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ha, Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: ELISA, Func, AP, PA, WB

Publications for TTYH3 Antibody (NBP2-30621) (0)

There are no publications for TTYH3 Antibody (NBP2-30621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTYH3 Antibody (NBP2-30621) (0)

There are no reviews for TTYH3 Antibody (NBP2-30621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TTYH3 Antibody (NBP2-30621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TTYH3 Products

Array NBP2-30621

Bioinformatics Tool for TTYH3 Antibody (NBP2-30621)

Discover related pathways, diseases and genes to TTYH3 Antibody (NBP2-30621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTYH3 Antibody (NBP2-30621)

Discover more about diseases related to TTYH3 Antibody (NBP2-30621).

PTMs for TTYH3 Antibody (NBP2-30621)

Learn more about PTMs related to TTYH3 Antibody (NBP2-30621).

Blogs on TTYH3

There are no specific blogs for TTYH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TTYH3 Antibody and receive a gift card or discount.


Gene Symbol TTYH3