Recombinant Human TSGA2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TSGA2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 200 - 309 of Human TSGA2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EELVTVVPKWKATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFRYDMDEGNINSEEEETRQSDLQD

Protein/Peptide Type
Partial Recombinant Protein
Gene
RSPH1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TSGA2 Protein

  • Cancer/testis antigen 79
  • CT79
  • FLJ32753
  • h-meichroacidin
  • Male meiotic metaphase chromosome-associated acidic protein
  • meichroacidin
  • radial spoke head 1 homolog (Chlamydomonas)
  • radial spoke head 1 homolog
  • RSP44
  • RSPH10A
  • testes specific A2 homolog
  • testes specific gene A2 homolog
  • testis specific A2 homolog (mouse)
  • testis specific A2 homolog
  • Testis-specific gene A2 protein
  • TSA2MGC126568
  • TSGA2MGC141927

Background

TSGA2 - testis specific A2 homolog (mouse)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004061-D01P
Species: Hu
Applications: WB
H00200576-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-19751
Species: Hu
Applications: WB
AF2485
Species: Hu
Applications: WB, IHC, IP
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-76652
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37395
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-91799
Species: Hu
Applications: WB, IHC, IHC-P
H00004507-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86654
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00089765-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TSGA2 Partial Recombinant Protein (H00089765-Q01) (0)

There are no publications for TSGA2 Partial Recombinant Protein (H00089765-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSGA2 Partial Recombinant Protein (H00089765-Q01) (0)

There are no reviews for TSGA2 Partial Recombinant Protein (H00089765-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSGA2 Partial Recombinant Protein (H00089765-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TSGA2 Products

Bioinformatics Tool for TSGA2 Partial Recombinant Protein (H00089765-Q01)

Discover related pathways, diseases and genes to TSGA2 Partial Recombinant Protein (H00089765-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSGA2 Partial Recombinant Protein (H00089765-Q01)

Discover more about diseases related to TSGA2 Partial Recombinant Protein (H00089765-Q01).
 

Pathways for TSGA2 Partial Recombinant Protein (H00089765-Q01)

View related products by pathway.

PTMs for TSGA2 Partial Recombinant Protein (H00089765-Q01)

Learn more about PTMs related to TSGA2 Partial Recombinant Protein (H00089765-Q01).
 

Research Areas for TSGA2 Partial Recombinant Protein (H00089765-Q01)

Find related products by research area.

Blogs on TSGA2

There are no specific blogs for TSGA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF
TSGA2 Antibody
NBP1-89840

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TSGA2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RSPH1