Recombinant Human TSGA10 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TSGA10 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 599-698 of Human TSGA10 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LCLAENKMAIQSRDVAQFRNVVTQLEADLDITKRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCHSPERAHHRSPDRGLDRSLEENLCYRDF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TSGA10

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TSGA10 Protein

  • cancer/testis antigen 79
  • CEP4LCT79
  • Testis development protein NYD-SP7
  • testis specific, 10
  • testis-specific gene 10 protein

Background

TSGA10 - testis specific, 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6184
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
NBP2-49265
Species: Hu
Applications: IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
H00058524-R01
Species: Hu
NBP1-90195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13367
Species: Hu
Applications: IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-32875
Species: Hu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF4885
Species: Mu
Applications: WB, IP
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87098
Species: Hu
Applications: IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00080705-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TSGA10 Partial Recombinant Protein (H00080705-Q01) (0)

There are no publications for TSGA10 Partial Recombinant Protein (H00080705-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TSGA10 Partial Recombinant Protein (H00080705-Q01) (0)

There are no reviews for TSGA10 Partial Recombinant Protein (H00080705-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TSGA10 Partial Recombinant Protein (H00080705-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TSGA10 Products

Bioinformatics Tool for TSGA10 Partial Recombinant Protein (H00080705-Q01)

Discover related pathways, diseases and genes to TSGA10 Partial Recombinant Protein (H00080705-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TSGA10 Partial Recombinant Protein (H00080705-Q01)

Discover more about diseases related to TSGA10 Partial Recombinant Protein (H00080705-Q01).
 

Pathways for TSGA10 Partial Recombinant Protein (H00080705-Q01)

View related products by pathway.

Blogs on TSGA10

There are no specific blogs for TSGA10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TSGA10 Antibody (6E8)
H00080705-M08

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TSGA10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TSGA10