Tryptase epsilon/BSSP-4/PRSS22 Antibody


Western Blot: Tryptase epsilon/BSSP-4/PRSS22 Antibody [NBP1-70688] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Tryptase epsilon/BSSP-4/PRSS22 Antibody Summary

Synthetic peptides corresponding to PRSS22 (protease, serine, 22) The peptide sequence was selected from the N terminal of PRSS22)(50ug). Peptide sequence IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PRSS22 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Tryptase epsilon/BSSP-4/PRSS22 Antibody

  • BSP-2
  • BSSP4
  • BSSP-4
  • hBSSP-4
  • MGC9599
  • prosemin
  • protease, serine S1 family member 22
  • protease, serine, 22
  • PRSS22
  • serine protease 22
  • serine protease 26
  • SP001LA
  • Tryptase epsilon
  • UNQ302/PRO343


This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688) (0)

There are no publications for Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688) (0)

There are no reviews for Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Tryptase epsilon/BSSP-4/PRSS22 Products

Bioinformatics Tool for Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688)

Discover related pathways, diseases and genes to Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688)

Discover more about diseases related to Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688).

Pathways for Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688)

View related products by pathway.

PTMs for Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688)

Learn more about PTMs related to Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688).

Blogs on Tryptase epsilon/BSSP-4/PRSS22

There are no specific blogs for Tryptase epsilon/BSSP-4/PRSS22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Tryptase epsilon/BSSP-4/PRSS22 Antibody and receive a gift card or discount.


Gene Symbol PRSS22