Tryptase epsilon/BSSP-4/PRSS22 Antibody

Western Blot: Tryptase epsilon/BSSP-4/PRSS22 Antibody [NBP1-70688] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Tryptase epsilon/BSSP-4/PRSS22 Antibody Summary

• Immunogen: Synthetic peptides corresponding to PRSS22 (protease, serine, 22) The peptide sequence was selected from the N terminal of PRSS22)(50ug). Peptide sequence IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRSS22
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.2-1 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against PRSS22 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Tryptase epsilon/BSSP-4/PRSS22 Antibody

• BSP-2
• BSSP4
• BSSP-4
• hBSSP-4
• MGC9599
• prosemin
• protease, serine S1 family member 22
• protease, serine, 22
• PRSS22
• serine protease 22
• serine protease 26
• SP001LA
• Tryptase epsilon
• UNQ302/PRO343

Background

This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRSS22
• Entrez:
  • 64063(Human)
  • 70835(Mouse)