Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.
![Western Blot: Tryptase epsilon/BSSP-4/PRSS22 Antibody [NBP1-70688] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/Tryptase-epsilon-BSSP-4-PRSS22-Antibody-Western-Blot-NBP1-70688-img0003.jpg "Western Blot: Tryptase epsilon/BSSP-4/PRSS22 Antibody [NBP1-70688] - HepG2 cell lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to PRSS22 (protease, serine, 22) The peptide sequence was selected from the N terminal of PRSS22)(50ug). Peptide sequence IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PRSS22 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against PRSS22 and was validated on Western blot. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Marapsin/Pancreasin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Marapsin/Pancreasin Antibody [Unconjugated]")
![Flow Cytometry: Tryptase gamma Antibody (1G1) [NBP2-01679] - Analysis of Hela cells, using anti-Tryptase gamma antibody, (Red), compared to a nonspecific negative control antibody (Blue).](http://images.novusbio.com/images/Tryptase-gamma-Antibody-(1G1)-Flow-Cytometry-NBP2-01679-img0001.jpg)
![Flow Cytometry: Tryptase gamma Antibody (1G1) [NBP2-01679] - Analysis of Jurkat cells, using anti-Tryptase gamma antibody, (Red), compared to a nonspecific negative control antibody (Blue).](http://images.novusbio.com/images/Tryptase-gamma-Antibody-(1G1)-Flow-Cytometry-NBP2-01679-img0002.jpg)
![Western Blot: Tryptase gamma Antibody (1G1) [NBP2-01679] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Tryptase gamma (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Tryptase gamma.](http://images.novusbio.com/images/Tryptase-gamma-Antibody-(1G1)-Western-Blot-NBP2-01679-img0003.jpg)
![Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Feline corneal stromal cells. IHC-Fr and IF (Alexa Fluor488) were performed using NBP1-91258 at 1:400. Image captured by epifluorescent microscopy. Image from verified customer review.](http://images.novusbio.com/images2/Fibronectin-Antibody-Immunohistochemistry-Frozen-NBP1-91258-img0013.jpg)
![Western Blot: Fibronectin Antibody [NBP1-91258] - Analysis of Fibronectin in HepG2 cell lysate.](http://images.novusbio.com/images/Fibronectin-Antibody-Western-Blot-NBP1-91258-img0003.jpg)
![Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Trabecular meshwork (TM) region of pig eyes. NBP1-91258 Fibronectin antibody was labelled with Alexa Fluor 488 conjugated secondary antibody (Green). DAPI shown as blue. Image from verified customer review.](http://images.novusbio.com/images2/Fibronectin-Antibody-Immunohistochemistry-Frozen-NBP1-91258-img0016.jpg)
![Flow Cytometry: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of CRC cells with Cytokeratin 20 antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.](http://images.novusbio.com/images2/Cytokeratin-20-Antibody-(SA35-03)-Flow-Cytometry-NBP2-67309-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Staining Cytokeratin 20 in CRC cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Cytokeratin-20-Antibody-(SA35-03)-Immunocytochemistry-Immunofluorescence-NBP2-67309-img0002.jpg)
![Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody (SA35-03) [NBP2-67309] - Analysis of paraffin-embedded human colon cancer tissue using anti-Cytokeratin 20 antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/Cytokeratin-20-Antibody-(SA35-03)-Immunohistochemistry-Paraffin-NBP2-67309-img0003.jpg)
![Western Blot: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Glucose 6 phosphate isomerase(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Glucose 6 phosphate isomerase.](http://images.novusbio.com/images/Glucose-6-phosphate-isomerase-Antibody-(2D2)-Western-Blot-NBP2-02541-img0001.jpg)
![Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Adenocarcinoma of Human ovary tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.](http://images.novusbio.com/images/Glucose-6-phosphate-isomerase-Antibody-(2D2)-Immunohistochemistry-Paraffin-NBP2-02541-img0002.jpg)
![Immunohistochemistry-Paraffin: Glucose 6 phosphate isomerase Antibody (2D2) [NBP2-02541] - Staining of paraffin-embedded Carcinoma of Human prostate tissue using anti-Glucose 6 phosphate isomerasemouse monoclonal antibody.](http://images.novusbio.com/images/Glucose-6-phosphate-isomerase-Antibody-(2D2)-Immunohistochemistry-Paraffin-NBP2-02541-img0003.jpg)
![Western Blot: GNPDA1 Antibody [NBP2-24653] - analysis of GNPDA1 in human spleen lysate in the 1) absence and 2) presence of immunizing peptide 3) mouse spleen and 4) rat spleen using GNPDA1 antibody at 1.0 ug/ml, 0.5 ug/ml and 0.5 ug/ml, respectively.](http://images.novusbio.com/images2/GNPDA1-Antibody-Western-Blot-NBP2-24653-img0001.jpg)
![Immunohistochemistry-Paraffin: GNPDA1 Antibody [NBP2-24653] - Formalin-fixed paraffin-embedded human kidney tissue stained with GNPDA1 antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.](http://images.novusbio.com/images2/GNPDA1-Antibody-Immunohistochemistry-Paraffin-NBP2-24653-img0002.jpg)
Secondary Antibodies |
Isotype Controls |
PTMs for Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688)Learn more about PTMs related to Tryptase epsilon/BSSP-4/PRSS22 Antibody (NBP1-70688).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PRSS22 |
![Immunohistochemistry-Paraffin: Tryptase alpha/TPS1 Antibody (AA1) [NBP2-26444] - Human tonsil stained with Mast Cell Tryptase antibody.](http://images.novusbio.com/images2/Tryptase-alpha-TPS1-Antibody-(AA1)-Immunohistochemistry-Paraffin-NBP2-26444-img0005.jpg)
![Immunohistochemistry-Paraffin: Tryptase alpha/TPS1 Antibody (AA1) [NBP2-26444] - Analysis of Mast Cell Tryptase formalin-fixed paraffin embedded human tonsil using NBP2-26444.](http://images.novusbio.com/images2/Tryptase-alpha-TPS1-Antibody-(AA1)-Immunohistochemistry-Paraffin-NBP2-26444-img0003.jpg)
![Western Blot: t-Plasminogen Activator/tPA Antibody [NBP2-20648] - Human plasma (30 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with tPA antibody diluted at 1:2000.](http://images.novusbio.com/images2/t-Plasminogen-Activator-tPA-Antibody-Western-Blot-NBP2-20648-img0016.jpg)
![Western Blot: t-Plasminogen Activator/tPA Antibody [NBP2-20648] - Sample (30 ug of whole cell lysate) A: 293T 7. 5% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/t-Plasminogen-Activator-tPA-Antibody-Western-Blot-NBP2-20648-img0017.jpg)
![Western Blot: t-Plasminogen Activator/tPA Antibody [NBP2-20648] - A. 30 ug Neuro2A whole cell lysate/extract 7.5% SDS-PAGE tPA antibody dilution: 1:1000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/images2/t-Plasminogen-Activator-tPA-Antibody-Western-Blot-NBP2-20648-img0018.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](http://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")