Tryptase alpha/TPS1 Antibody

Images

 
Western Blot: Tryptase alpha/TPS1 Antibody [H00007177-B02P] - Analysis of TPSAB1 expression in human kidney.
Western Blot: Tryptase alpha/TPS1 Antibody [H00007177-B02P] - Analysis of TPSAB1 expression in transfected 293T cell line by TPSAB1 polyclonal antibody. Lane 1: TPSAB1 transfected lysate(30.25 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Tryptase alpha/TPS1 Antibody Summary

Immunogen
TPSAB1 (NP_003285, 1 a.a. - 275 a.a.) full-length human protein. MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TPSAB1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Tryptase alpha/TPS1 Antibody

  • TPS1
  • TPS2
  • TPSAB1
  • TPSB1
  • Tryptase 1
  • Tryptase alpha
  • tryptase alpha/beta 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01679
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-31981
Species: Hu
Applications: IHC, IHC-P
MAB4099
Species: Hu
Applications: WB, IP
NBP1-32794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-108
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-87411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow

Publications for Tryptase alpha/TPS1 Antibody (H00007177-B02P) (0)

There are no publications for Tryptase alpha/TPS1 Antibody (H00007177-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tryptase alpha/TPS1 Antibody (H00007177-B02P) (0)

There are no reviews for Tryptase alpha/TPS1 Antibody (H00007177-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tryptase alpha/TPS1 Antibody (H00007177-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tryptase alpha/TPS1 Products

Bioinformatics Tool for Tryptase alpha/TPS1 Antibody (H00007177-B02P)

Discover related pathways, diseases and genes to Tryptase alpha/TPS1 Antibody (H00007177-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptase alpha/TPS1 Antibody (H00007177-B02P)

Discover more about diseases related to Tryptase alpha/TPS1 Antibody (H00007177-B02P).
 

Pathways for Tryptase alpha/TPS1 Antibody (H00007177-B02P)

View related products by pathway.

PTMs for Tryptase alpha/TPS1 Antibody (H00007177-B02P)

Learn more about PTMs related to Tryptase alpha/TPS1 Antibody (H00007177-B02P).

Blogs on Tryptase alpha/TPS1

There are no specific blogs for Tryptase alpha/TPS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tryptase alpha/TPS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPSAB1
Entrez
Uniprot