Troponin I Type 3 (cardiac) Antibody (1E7)

Images

 
Western Blot: Troponin I Type 3 (cardiac) Antibody (1E7) [H00007137-M04] - Analysis of TNNI3 expression in transfected 293T cell line by TNNI3 monoclonal antibody (M04), clone 1E7. Lane 1: TNNI3 transfected lysatE (24 ...read more
Immunocytochemistry/ Immunofluorescence: Troponin I Type 3 (cardiac) Antibody (1E7) [H00007137-M04] - Analysis of monoclonal antibody to TNNI3 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: Troponin I Type 3 (cardiac) Antibody (1E7) [H00007137-M04] - Analysis of monoclonal antibody to TNNI3 on formalin-fixed paraffin-embedded human heart. Antibody concentration 0.7 ug/ml
Western Blot: Troponin I Type 3 (cardiac) Antibody (1E7) [H00007137-M04] - Western blot analysis of TNNI3 over-expressed 293 cell line, cotransfected with TNNI3 Validated Chimera RNAi or non-transfected control. Blot ...read more
ELISA: Troponin I Type 3 (cardiac) Antibody (1E7.) [H00007137-M04] - Troponin I Type 3 (cardiac) Antibody (1E7) [H00007137-M04] - Detection limit for recombinant GST tagged TNNI3 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP, KD
Clone
1E7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Troponin I Type 3 (cardiac) Antibody (1E7) Summary

Immunogen
TNNI3 (NP_000354, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES
Specificity
TNNI3 - troponin I type 3 (cardiac)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TNNI3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Knockdown Validated
  • Western Blot
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for RNAi validaton, IHC-P and ELISA.
Publications
Read Publication using H00007137-M04.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Troponin I Type 3 (cardiac) Antibody (1E7)

  • Cardiac troponin I
  • CMD1FF
  • CMD2A
  • CMH7MGC116817
  • CTnI
  • familial hypertrophic cardiomyopathy 7
  • RCM1
  • TNNC1
  • TNNC1troponin I, cardiac
  • TNNI3,
  • troponin I type 3 (cardiac)
  • troponin I, cardiac muscle
  • Troponin I/TNNI3

Background

Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit; blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. This gene encodes the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues. Mutations in this gene cause familial hypertrophic cardiomyopathy type 7 (CMH7) and familial restrictive cardiomyopathy (RCM).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
8184-CK
Species: Hu
Applications: EnzAct
DCRP00
Species: Hu
Applications: ELISA
MAB1678
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-46201
Species: Hu
Applications: IHC, IHC-P, WB
MAB9096
Species: Hu
Applications: IHC, WB
MAB1874
Species: Hu
Applications: ICC, IHC
MAB1266
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
210-TA
Species: Hu
Applications: BA
NBP2-15698
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
AF7439
Species: Hu
Applications: IHC, WB
H00007137-M04
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, KD

Publications for Troponin I Type 3 (cardiac) Antibody (H00007137-M04)(1)

Reviews for Troponin I Type 3 (cardiac) Antibody (H00007137-M04) (0)

There are no reviews for Troponin I Type 3 (cardiac) Antibody (H00007137-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Troponin I Type 3 (cardiac) Antibody (H00007137-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Troponin I Type 3 (cardiac) Products

Bioinformatics Tool for Troponin I Type 3 (cardiac) Antibody (H00007137-M04)

Discover related pathways, diseases and genes to Troponin I Type 3 (cardiac) Antibody (H00007137-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Troponin I Type 3 (cardiac) Antibody (H00007137-M04)

Discover more about diseases related to Troponin I Type 3 (cardiac) Antibody (H00007137-M04).
 

Pathways for Troponin I Type 3 (cardiac) Antibody (H00007137-M04)

View related products by pathway.

PTMs for Troponin I Type 3 (cardiac) Antibody (H00007137-M04)

Learn more about PTMs related to Troponin I Type 3 (cardiac) Antibody (H00007137-M04).
 

Research Areas for Troponin I Type 3 (cardiac) Antibody (H00007137-M04)

Find related products by research area.

Blogs on Troponin I Type 3 (cardiac).

Troponin I Type 3 (TnI, cardiac)
Troponin I is part of a heteromeric thin filament regulatory complex that governs skeletal and cardiac muscle contraction. Troponin I is composed of three subunits: troponin I (TnI), troponin T (TnT), and troponin C (TnC), and each of these components...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Troponin I Type 3 (cardiac) Antibody (1E7) and receive a gift card or discount.

Bioinformatics

Gene Symbol TNNI3
Entrez
OMIM
Uniprot