Recombinant Human TRIM44 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TRIM44 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-344 of Human TRIM44 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TRIM44
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRIM44 Protein

  • DIPBMGC3490
  • HSA249128
  • MC7
  • Protein DIPB
  • tripartite motif containing 44
  • tripartite motif-containing 44
  • tripartite motif-containing protein 44

Background

This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00009060-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-83954
Species: Hu
Applications: IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-89716
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32442
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-88117
Species: Hu
Applications: WB (-), WB, IHC, IHC-P, IP
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-31775
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31983
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for TRIM44 Recombinant Protein (H00054765-P01) (0)

There are no publications for TRIM44 Recombinant Protein (H00054765-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM44 Recombinant Protein (H00054765-P01) (0)

There are no reviews for TRIM44 Recombinant Protein (H00054765-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM44 Recombinant Protein (H00054765-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM44 Products

Bioinformatics Tool for TRIM44 Recombinant Protein (H00054765-P01)

Discover related pathways, diseases and genes to TRIM44 Recombinant Protein (H00054765-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM44 Recombinant Protein (H00054765-P01)

Discover more about diseases related to TRIM44 Recombinant Protein (H00054765-P01).
 

Pathways for TRIM44 Recombinant Protein (H00054765-P01)

View related products by pathway.

PTMs for TRIM44 Recombinant Protein (H00054765-P01)

Learn more about PTMs related to TRIM44 Recombinant Protein (H00054765-P01).

Blogs on TRIM44

There are no specific blogs for TRIM44, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRIM44 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM44