Recombinant Human TRIM35 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TRIM35 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-493 of Human TRIM35 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPADLRTNHTLNNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLCCSCQADPRHQGHRVQPVKDTAHDFRAKCRNMEHALREKAKAFWAMRRSYEAIAKHNQVEAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHEIERLQMEMKEDDVSFLMKHKSRKRRLFCTMEPEPVQPGMLIDVCKYLGSLQYRVWKKMLASVESVPFSFDPNTAAGWLSVSDDLTSVTNHGYRVQVENPERFSSAPCLLGSRVFSQGSHAWEVALGGLQSWRVGVVRVRQDSGAEGHSHSCYHDTRSGFWYVCRTQGVEGDHCVTSDPATSPLVLAIPRRLRVELECEEGELSFYDAERHCHLYTFHARFGEVRPYFYLGGARGAGPPEPLRICPLHISVKEELDG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TRIM35
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
82.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRIM35 Protein

  • HLS5Hemopoietic lineage switch protein 5
  • KIAA1098MGC17233
  • MAIR
  • tripartite motif containing 35
  • tripartite motif-containing 35
  • tripartite motif-containing protein 35

Background

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-79784
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
MAB5240
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-47492
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-68241
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-27152
Species: Mu
Applications: WB
H00006635-P01
Species: Hu
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-04266
Species: Hu, Mu
Applications: WB, ELISA
NBP1-83276
Species: Hu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16456
Species: Hu
Applications: WB, IHC, IHC-P
AF2580
Species: Mu
Applications: WB
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
MAB2774
Species: Hu
Applications: Flow, CyTOF-ready, ICC

Publications for TRIM35 Recombinant Protein (H00023087-P01) (0)

There are no publications for TRIM35 Recombinant Protein (H00023087-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM35 Recombinant Protein (H00023087-P01) (0)

There are no reviews for TRIM35 Recombinant Protein (H00023087-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM35 Recombinant Protein (H00023087-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRIM35 Products

Bioinformatics Tool for TRIM35 Recombinant Protein (H00023087-P01)

Discover related pathways, diseases and genes to TRIM35 Recombinant Protein (H00023087-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM35 Recombinant Protein (H00023087-P01)

Discover more about diseases related to TRIM35 Recombinant Protein (H00023087-P01).
 

Pathways for TRIM35 Recombinant Protein (H00023087-P01)

View related products by pathway.

Research Areas for TRIM35 Recombinant Protein (H00023087-P01)

Find related products by research area.

Blogs on TRIM35

There are no specific blogs for TRIM35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TRIM35 Antibody
NBP1-81733

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRIM35 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM35