TMPRSS4 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMPRSS4. Source: E. coli
Amino Acid Sequence: DVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMM Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TMPRSS4 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82608. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TMPRSS4 Recombinant Protein Antigen
Background
TMPRSS4, previously known as TMPRSS3, is a 437 amino acid type II transmembrane serine protease located on human chromosome 11q23.3 that encodes 5 isoforms containing a complete coding sequence. This serine protease has a predicted molecular weight of 48 kDa with 2 glycosylation sites and the cleaved soluble protease domain has been detected in cell culture media. Functions of TMPRSS4 include embryo development, viral infection, and cancer. TMPRSS4 plays a role in the epithelial-mesenchymal transition (EMT) process and mediates cell invasion, migration, proliferation and metastasis. Overexpression of TMPRSS4 has been reported for multiple solid tumors including pancreatic, ovarian, thyroid, colorectal, lung, breast, cervical, gallbladder, gastric, and liver cancer, and has been associated with poor overall survival and reduced time to tumor progression (1,2).
TMPRSS4 has also been shown to play a role in the process of viral entry for coronaviruses and influenza viruses thru proteolytic activation of key viral glycoproteins. One pathway for SARS-CoV-2 infection, which causes the COVID-19 disease, involves binding of the SARS-CoV-2 Spike 'S' glycoprotein to the human ACE2 receptor and cleavage of S by TMPRSS2 or potentially by TMPRSS4 at the cell surface to facilitate viral entry (3).
References
1. L de Aberasturi A, Calvo A. (2015) TMPRSS4: An Emerging Potential Therapeutic Target in Cancer. Br J Cancer. 112(1):4-8. PMID: 25203520
2. Zeng P., Zhang P., Zhou L., Tang M., Shen Y., Jin J., Zhu Y., Chen M. (2016) TMPRSS4 as an emerging potential poor prognostic factor for solid tumors: A systematic review and meta-analysis. Oncotarget. 7:76327-76336. PMID: 27344186
3. Zang F, Castro MFG, McCune BT, Zeng Q, Rothlauf PW, Sonnek NM, Liu Z, Brulois KF, Wang X, Greenberg HB, Diamond MS, Ciorba MA, Whelan SPJ, and Ding S. (2020) TMPRSS2 and TMPRSS4 promote SARS-CoV-2 infection of human small intestinal enterocytes. Sci Immunol. 5(47): eabc3582. PMID: 32404436
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, Simple Western, WB
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IP, Simple Western, WB
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for TMPRSS4 Recombinant Protein Antigen (NBP1-82608PEP) (0)
There are no publications for TMPRSS4 Recombinant Protein Antigen (NBP1-82608PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TMPRSS4 Recombinant Protein Antigen (NBP1-82608PEP) (0)
There are no reviews for TMPRSS4 Recombinant Protein Antigen (NBP1-82608PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TMPRSS4 Recombinant Protein Antigen (NBP1-82608PEP) (0)
Additional TMPRSS4 Products
Research Areas for TMPRSS4 Recombinant Protein Antigen (NBP1-82608PEP)
Find related products by research area.
|
Blogs on TMPRSS4