TMEM98 Antibody - BSA Free

Western Blot: TMEM98 Antibody [NBP1-84154] - Expression of selected genes in BCC subsets. Western blots for GPR64, TMEM98, FAT4, RAP1A and FN1 using whole cell extracts expression from Oct4hi, Octmed and Oct4low, isolated as for 'A'. The results represent four different independent experiments. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-017-18834-5), licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: TMEM98 Antibody [NBP1-84154] - Staining of human cell line A-431 shows positivity in cytoplasm and nucleus but excluded from the nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TMEM98 Antibody [NBP1-84154] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Flow Cytometry: TMEM98 Antibody [NBP1-84154] - Characterization of BCC subsets. MDA-MB-231, stably transfected with Oct4-GFP (left panel), was labeled with PE-anti-TMEM-98, -GPR64 and -FAT4 and analyzed by flow cytometry based on the relative GFP levels (n=5). Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-017-18834-5#additional-information), licensed under a CC-BY license.

Expression of selected genes in BCC subsets. (A) Real time PCR for GPR64, FAT4, TMEM98, ALOX5 AP, DUSP4, RAP1A & FN1. The RNA was isolated from Oct4hi, Octmed & Oct4low subsets from MDA-MB-231 stably transfected with pEGFP1-Oct3/4. The results are shown as relative to beta -actin expression with mean ± SD for four independent experiments. (B) Western blots for GPR64, TMEM98, FAT4, RAP1A & FN1 using whole cell extracts expression from Oct4hi, Octmed & Oct4low, isolated as for ‘A’. The results represent four different independent experiments. Image collected & cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-017-18834-5), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Flow, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEM98 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TMEM98 Antibody - BSA Free (NBP1-84154) is a polyclonal antibody validated for use in IHC, WB, Flow and ICC/IF. Anti-TMEM98 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVITNPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVS
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM98
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 1:100-1:500
• Application Notes: WB reported in scientific literature (PMID: 29321622). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TMEM98 Recombinant Protein Antigen (NBP1-84154PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TMEM98 Antibody - BSA Free

• DKFZP564K1964
• Protein TADA1
• transmembrane protein 98

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM98 Antibody (NBP1-84154)(1)

Publication using NBP1-84154

• Bliss SA, Paul S, Pobiarzyn PW et al. Evaluation of a developmental hierarchy for breast cancer cells to assess risk-based patient selection for targeted treatment Sci Rep 2018-01-10 [PMID: 29321622] (WB, Human)

Bioinformatics

• Gene Symbol: TMEM98