Recombinant Human TMEM34 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TMEM34 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-261 of Human TMEM34 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPCTCTWRNWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTIPISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAYVIYNFMGFLTNYLTNRYPNLVLILEAKDQQKHFPPLCCCPPWAMGEVLLFRCKLGVLQYTVVRPFTTIVALICELLGIYDEGNFSFSNAWTYLVIINNMSQLFAMYCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TMEM184C
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TMEM34 Protein

  • TMEM34
  • transmembrane protein 184C
  • Transmembrane protein 34FLJ10846

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP1-84466
Species: Hu
Applications: WB, IHC, IHC-P
MAB4165
Species: Hu
Applications: WB, IHC
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81887
Species: Hu
Applications: IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
AF2569
Species: Hu
Applications: WB, ICC
H00006187-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055751-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for TMEM34 Recombinant Protein (H00055751-P01) (0)

There are no publications for TMEM34 Recombinant Protein (H00055751-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM34 Recombinant Protein (H00055751-P01) (0)

There are no reviews for TMEM34 Recombinant Protein (H00055751-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM34 Recombinant Protein (H00055751-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMEM34 Products

Bioinformatics Tool for TMEM34 Recombinant Protein (H00055751-P01)

Discover related pathways, diseases and genes to TMEM34 Recombinant Protein (H00055751-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM34 Recombinant Protein (H00055751-P01)

Discover more about diseases related to TMEM34 Recombinant Protein (H00055751-P01).

Blogs on TMEM34

There are no specific blogs for TMEM34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TMEM34 Antibody
NBP2-30760

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TMEM34 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM184C