TMEM34 Recombinant Protein Antigen (NBP2-30760PEP)

Images

 
There are currently no images for TMEM34 Protein (NBP2-30760PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TMEM34 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMEM184C.

Source: E.coli

Amino Acid Sequence: LSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEILSDTIGEKKEPSDKSVD

Protein/Peptide Type
Recombinant Protein Antigen
Gene
TMEM184C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-30760.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TMEM34 Recombinant Protein Antigen

  • TMEM34
  • transmembrane protein 184C
  • Transmembrane protein 34FLJ10846

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP1-84466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4165
Species: Hu
Applications: WB, IHC
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81887
Species: Hu
Applications: IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
AF2569
Species: Hu
Applications: WB, ICC
H00006187-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP1-84297
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30760PEP
Species: Hu
Applications: AC

Publications for TMEM34 Protein (NBP2-30760PEP) (0)

There are no publications for TMEM34 Protein (NBP2-30760PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM34 Protein (NBP2-30760PEP) (0)

There are no reviews for TMEM34 Protein (NBP2-30760PEP). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for TMEM34 Protein (NBP2-30760PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMEM34 Products

Related Products by Gene

Bioinformatics Tool for TMEM34 Protein (NBP2-30760PEP)

Discover related pathways, diseases and genes to TMEM34 Protein (NBP2-30760PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM34 Protein (NBP2-30760PEP)

Discover more about diseases related to TMEM34 Protein (NBP2-30760PEP).

Blogs on TMEM34

There are no specific blogs for TMEM34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TMEM34 Antibody
NBP2-30760
TMEM34 Antibody
NBP2-30760
TMEM34 Antibody
NBP2-30760

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TMEM34 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM184C