TMEM189 Antibody - BSA Free

Western Blot: TMEM189 Antibody [NBP2-94610] - Analysis of extracts of MCF-7 cells, using TMEM189 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure tim

Immunohistochemistry-Paraffin: TMEM189 Antibody [NBP2-94610] - Human stomach using TMEM189 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: TMEM189 Antibody [NBP2-94610] - Human liver using TMEM189 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEM189 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TMEM189 Antibody - BSA Free (NBP2-94610) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 171-270 of human TMEM189 (NP_954580.1). FVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PEDS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TMEM189 Antibody - BSA Free

• KUA
• transmembrane protein 189
• UBE2V1
• ubiquitin-conjugating enzyme E2 variant 1

Background

Co-transcription of this gene and the neighboring downstream gene (UBE2V1) generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The product of the Kua gene has UEV1 B domains but this protein is localized to the cytoplasm rather than to the nucleus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PEDS1