TMEM189 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TMEM189 Antibody [NBP2-32476] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TMEM189 Antibody [NBP2-32476] - Staining of human cerebellum shows distinct positivity in processes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEM189 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TMEM189 Antibody - BSA Free (NBP2-32476) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKI
• Predicted Species: Mouse (98%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PEDS1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TMEM189 Protein (NBP2-32476PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM189 Antibody - BSA Free

• KUA
• transmembrane protein 189
• UBE2V1
• ubiquitin-conjugating enzyme E2 variant 1

Background

Co-transcription of this gene and the neighboring downstream gene (UBE2V1) generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The product of the Kua gene has UEV1 B domains but this protein is localized to the cytoplasm rather than to the nucleus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PEDS1