TMEM16K Antibody

Images

 
Immunohistochemistry-Paraffin: TMEM16K Antibody [NBP2-14297] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM16K Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVI LEKEMGTYLGTFDDYLEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANO10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM16K Protein (NBP2-14297PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM16K Antibody

  • anoctamin 10
  • FLJ10375
  • MGC47890
  • Transmembrane protein 16KTMEM16Kanoctamin-10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49799
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-74204
Species: Mu
Applications: WB
NBP1-31129
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86688
Species: Hu
Applications: IHC, IHC-P
NB100-98846
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-14298
Species: Hu
Applications: IHC, IHC-P
NBP2-14673
Species: Hu
Applications: IHC, IHC-P
NBP2-32401
Species: Hu
Applications: IHC, IHC-P
NBP1-83099
Species: Hu
Applications: IHC, IHC-P
NBP2-49081
Species: Hu
Applications: WB, IHC
H00255928-R01
Species: Hu
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-14297
Species: Hu
Applications: IHC, IHC-P

Publications for TMEM16K Antibody (NBP2-14297) (0)

There are no publications for TMEM16K Antibody (NBP2-14297).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM16K Antibody (NBP2-14297) (0)

There are no reviews for TMEM16K Antibody (NBP2-14297). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM16K Antibody (NBP2-14297) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM16K Products

Bioinformatics Tool for TMEM16K Antibody (NBP2-14297)

Discover related pathways, diseases and genes to TMEM16K Antibody (NBP2-14297). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM16K Antibody (NBP2-14297)

Discover more about diseases related to TMEM16K Antibody (NBP2-14297).
 

Pathways for TMEM16K Antibody (NBP2-14297)

View related products by pathway.

Blogs on TMEM16K

There are no specific blogs for TMEM16K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM16K Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANO10