TMEM147 Antibody

Images

 
Western Blot: TMEM147 Antibody [NBP1-79334] - Rat Brain Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM147 Antibody Summary

Immunogen
The immunogen for this antibody is Tmem147. Peptide sequence VTYLFVQLCKMLFLATFFPTWEGGIYDFIGEFMKASVDVADLIGLNLVMS. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM147
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Tmem147 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMEM147 Antibody

  • MGC1936
  • NIFIE14
  • Protein NIFIE 14
  • seven transmembrane domain protein
  • transmembrane protein 147

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81002
Species: Hu, Mu
Applications: IHC, IHC-P
H00408050-M03-100ug
Species: Hu
Applications: WB, ELISA
AF3755
Species: Hu
Applications: WB
NBP2-75632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-77270
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TMEM147 Antibody (NBP1-79334) (0)

There are no publications for TMEM147 Antibody (NBP1-79334).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM147 Antibody (NBP1-79334) (0)

There are no reviews for TMEM147 Antibody (NBP1-79334). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM147 Antibody (NBP1-79334) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMEM147 Products

Bioinformatics Tool for TMEM147 Antibody (NBP1-79334)

Discover related pathways, diseases and genes to TMEM147 Antibody (NBP1-79334). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM147 Antibody (NBP1-79334)

Discover more about diseases related to TMEM147 Antibody (NBP1-79334).
 

Pathways for TMEM147 Antibody (NBP1-79334)

View related products by pathway.

PTMs for TMEM147 Antibody (NBP1-79334)

Learn more about PTMs related to TMEM147 Antibody (NBP1-79334).

Blogs on TMEM147

There are no specific blogs for TMEM147, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM147 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM147
Uniprot