TMED4 Antibody

Product Discontinued

TMED4 Antibody Summary

• Immunogen: Synthetic peptides corresponding to TMED4(transmembrane emp24 protein transport domain containing 4) The peptide sequence was selected from the middle region of TMED4. Peptide sequence DIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREER.
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMED4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against TMED4 and was validated on Western blot.
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: No Preservative
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMED4 Antibody

• endoplasmic reticulum stress-response protein 25 kDa
• Endoplasmic reticulum stress-response protein 25
• ERS25
• HNLF
• Putative NF-kappa-B-activating protein 156
• putative NFkB activating protein HNLF
• transmembrane emp24 domain-containing protein 4
• transmembrane emp24 protein transport domain containing 4

Background

TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMED4
• Uniprot:
  • Q7Z7H5(Human)