TMED4 Antibody


Western Blot: TMED4 Antibody [NBP1-69259] - This Anti-TMED4 antibody was used in Western Blot of Liver tissue lysate at a concentration of 0.5ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TMED4 Antibody Summary

Synthetic peptides corresponding to TMED4(transmembrane emp24 protein transport domain containing 4) The peptide sequence was selected from the middle region of TMED4. Peptide sequence DIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREER.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMED4 and was validated on Western blot.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
TMED4 Lysate (NBP2-65865)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMED4 Antibody

  • endoplasmic reticulum stress-response protein 25 kDa
  • Endoplasmic reticulum stress-response protein 25
  • ERS25
  • HNLF
  • Putative NF-kappa-B-activating protein 156
  • putative NFkB activating protein HNLF
  • transmembrane emp24 domain-containing protein 4
  • transmembrane emp24 protein transport domain containing 4


TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Bv
Applications: WB, ELISA, IP
Species: Vi
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB

Publications for TMED4 Antibody (NBP1-69259) (0)

There are no publications for TMED4 Antibody (NBP1-69259).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMED4 Antibody (NBP1-69259) (0)

There are no reviews for TMED4 Antibody (NBP1-69259). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMED4 Antibody (NBP1-69259) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional TMED4 Products

Bioinformatics Tool for TMED4 Antibody (NBP1-69259)

Discover related pathways, diseases and genes to TMED4 Antibody (NBP1-69259). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMED4 Antibody (NBP1-69259)

Discover more about diseases related to TMED4 Antibody (NBP1-69259).

Blogs on TMED4

There are no specific blogs for TMED4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMED4 Antibody and receive a gift card or discount.


Gene Symbol TMED4