TMCO4 Antibody

Images

 
Western Blot: TMCO4 Antibody [NBP2-58413] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: TMCO4 Antibody [NBP2-58413] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMCO4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKE
Specificity
Specificity of human TMCO4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMCO4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TMCO4 Antibody

  • DKFZp686C23231
  • RP5-1056L3.6
  • transmembrane and coiled-coil domain-containing protein 4
  • transmembrane and coiled-coil domains 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-86391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1526
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-89331
Species: Hu
Applications: IHC, IHC-P
NBP2-45645
Species: Hu
Applications: WB, IHC, IF

Publications for TMCO4 Antibody (NBP2-58413) (0)

There are no publications for TMCO4 Antibody (NBP2-58413).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMCO4 Antibody (NBP2-58413) (0)

There are no reviews for TMCO4 Antibody (NBP2-58413). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TMCO4 Antibody (NBP2-58413) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP2-58413

Bioinformatics Tool for TMCO4 Antibody (NBP2-58413)

Discover related pathways, diseases and genes to TMCO4 Antibody (NBP2-58413). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMCO4 Antibody (NBP2-58413)

Discover more about diseases related to TMCO4 Antibody (NBP2-58413).

Blogs on TMCO4

There are no specific blogs for TMCO4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMCO4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMCO4