We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TFIIIC Recombinant Protein Antigen

Images

 
There are currently no images for TFIIIC Protein (NBP2-14077PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TFIIIC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GTF3C1.

Source: E. coli

Amino Acid Sequence: QVFIFLKKNAVIVDTTICDPHYNLARSSRPFERRLYVLNSMQDVENYWFDLQCVCLNTPLGVVRCPRVRKNSSTDQGSDEEGSLQKEQESAMDKHNLERKCAMLEYTTGSREVVDEGLIPGDGLGAAGLDSSFYG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GTF3C1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14077.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TFIIIC Recombinant Protein Antigen

  • general transcription factor 3C polypeptide 1
  • general transcription factor IIIC, polypeptide 1 (alpha subunit)
  • general transcription factor IIIC, polypeptide 1 (alpha subunit, 220kD )
  • general transcription factor IIIC, polypeptide 1, alpha 220kDa
  • TF3C-alpha
  • TFIIIC 220 kDa subunit
  • TFIIIC box B-binding subunit
  • TFIIIC
  • TFIIIC220DKFZp686A111
  • TFIIICalpha
  • Transcription factor IIIC 220 kDa subunit
  • Transcription factor IIIC subunit alpha

Background

General transcription factor 3C polypeptide 1 (GTF3C1/TFIIIC220) is a subunit of the TFIIIC DNA-binding factor required for transcription of tRNA and 5S rRNA genes by RNA polymerase III. Human TFIIIC is composed of six subunits: TFIIIC220, TFIIIC110, TFIIIC102, TFIIIC90 and TFIIIC63, and TFIIIC35. The functional contribution of GTF3C1/TFIIIC220 to the TFIIIC complex has not been fully determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55335
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-04017
Species: Hu
Applications: IP, WB
NBP2-86906
Species: Hu
Applications: IHC,  IHC-P, WB
2914-HT
Species: Hu
Applications: BA
NBP3-17176
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, Simple Western, WB
NBP1-84999
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00026469-B01P
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-34143
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, KD, WB
NB100-2866
Species: Hu
Applications: ICC/IF, IP, KD, WB
NBP3-35833
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00002976-B01P
Species: Hu
Applications: ICC/IF, WB

Publications for TFIIIC Protein (NBP2-14077PEP) (0)

There are no publications for TFIIIC Protein (NBP2-14077PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFIIIC Protein (NBP2-14077PEP) (0)

There are no reviews for TFIIIC Protein (NBP2-14077PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TFIIIC Protein (NBP2-14077PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TFIIIC Products

Array NBP2-14077PEP

Blogs on TFIIIC

There are no specific blogs for TFIIIC, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TFIIIC Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF3C1