TEX19 Antibody

Images

 
Immunohistochemistry: TEX19 Antibody [NBP2-30835] - Staining of human testis shows cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TEX19 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PPVSMRYEEEGMSYLYASWMYQLQHGDQLSICFTCFKAAFLDFKDLLESEDWEEDNWDPELMEHTEAESEQE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TEX19
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TEX19 Protein (NBP2-30835PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TEX19 Antibody

  • FLJ35767
  • testis expressed 19
  • testis-expressed sequence 19 protein
  • TEX19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB66451
Species: Mu
Applications: WB, ICC
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-45243
Species: Hu, Mu
Applications: WB, IHC-P, PEP-ELISA
NB100-2437
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30835
Species: Hu
Applications: IHC, IHC-P

Publications for TEX19 Antibody (NBP2-30835) (0)

There are no publications for TEX19 Antibody (NBP2-30835).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEX19 Antibody (NBP2-30835) (0)

There are no reviews for TEX19 Antibody (NBP2-30835). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TEX19 Antibody (NBP2-30835) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TEX19 Products

TEX19 NBP2-30835

Bioinformatics Tool for TEX19 Antibody (NBP2-30835)

Discover related pathways, diseases and genes to TEX19 Antibody (NBP2-30835). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TEX19 Antibody (NBP2-30835)

View related products by pathway.

PTMs for TEX19 Antibody (NBP2-30835)

Learn more about PTMs related to TEX19 Antibody (NBP2-30835).

Blogs on TEX19

There are no specific blogs for TEX19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEX19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TEX19
Entrez
Uniprot