Recombinant Human TEX15 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TEX15 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2690-2789 of Human TEX15

Source: Wheat Germ

Amino Acid Sequence: PSGLLTTVASTAQGTHSNLLYSQYFTYFAGEPQANGFVPVNGYFQSQIPASNFRQPIFSQYASHQPLPQATYPYLPNRFVPPEVPWVYAPWHQESFHPGH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TEX15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TEX15 Protein

  • CT42Cancer/testis antigen 42
  • DKFZp434M2415
  • testis expressed 15
  • testis expressed sequence 15
  • testis-expressed sequence 15 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-38889
Species: Hu
Applications: WB, IP
NB100-181
Species: Hu, Mu
Applications: WB, IP
NBP1-58172
Species: Hu
Applications: WB
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP1-80294
Species: Hu
Applications: WB
MAB2476
Species: Hu
Applications: WB, IHC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-15049
Species: Hu
Applications: WB, ICC/IF
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NBP1-84350
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86521
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-92227
Species: Hu
Applications: IHC, IHC-P
AF6296
Species: Hu
Applications: WB
NBP2-02667
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
126-FL/CF
Species: Hu
NBP1-59482
Species: Hu
Applications: WB
H00056154-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for TEX15 Partial Recombinant Protein (H00056154-Q01) (0)

There are no publications for TEX15 Partial Recombinant Protein (H00056154-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEX15 Partial Recombinant Protein (H00056154-Q01) (0)

There are no reviews for TEX15 Partial Recombinant Protein (H00056154-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEX15 Partial Recombinant Protein (H00056154-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TEX15 Products

TEX15 H00056154-Q01

Bioinformatics Tool for TEX15 Partial Recombinant Protein (H00056154-Q01)

Discover related pathways, diseases and genes to TEX15 Partial Recombinant Protein (H00056154-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEX15 Partial Recombinant Protein (H00056154-Q01)

Discover more about diseases related to TEX15 Partial Recombinant Protein (H00056154-Q01).
 

Pathways for TEX15 Partial Recombinant Protein (H00056154-Q01)

View related products by pathway.

PTMs for TEX15 Partial Recombinant Protein (H00056154-Q01)

Learn more about PTMs related to TEX15 Partial Recombinant Protein (H00056154-Q01).

Blogs on TEX15

There are no specific blogs for TEX15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TEX15 Antibody
NBP1-84347

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TEX15 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TEX15