TEKT3 Antibody

Images

 
Western Blot: TEKT3 Antibody [NBP1-74181] - Rat Muscle Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TEKT3 Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of Tekt3. Immunizing peptide sequence MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TEKT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Tekt3 and was validated on Western blot.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TEKT3 Antibody

  • FLJ32828
  • tektin 3
  • tektin-3
  • testicular microtubules-related protein

Background

Tekt3 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules. It is required for progressive sperm mobility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-13425
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBL1-15012
Species: Hu
NBP1-88090
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-34174
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF5414
Species: Hu
Applications: WB, Simple Western
AF6318
Species: Hu
Applications: ICC
AF7276
Species: Hu
Applications: WB
NBP1-74181
Species: Rt
Applications: WB

Publications for TEKT3 Antibody (NBP1-74181) (0)

There are no publications for TEKT3 Antibody (NBP1-74181).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEKT3 Antibody (NBP1-74181) (0)

There are no reviews for TEKT3 Antibody (NBP1-74181). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEKT3 Antibody (NBP1-74181) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TEKT3 Products

Bioinformatics Tool for TEKT3 Antibody (NBP1-74181)

Discover related pathways, diseases and genes to TEKT3 Antibody (NBP1-74181). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEKT3 Antibody (NBP1-74181)

Discover more about diseases related to TEKT3 Antibody (NBP1-74181).
 

Pathways for TEKT3 Antibody (NBP1-74181)

View related products by pathway.

Blogs on TEKT3

There are no specific blogs for TEKT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEKT3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TEKT3
Uniprot