FAM18B Antibody

Images

 
Western Blot: FAM18B Antibody [NBP1-88090] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: FAM18B Antibody [NBP1-88090] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: FAM18B Antibody [NBP1-88090] - Staining of human lung shows strong membranous positivity in alveolar cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM18B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TVP23B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM18B Protein (NBP1-88090PEP)
Publications
Read Publication using
NBP1-88090 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (82%). Human reactivity reported in scientific literature (PMID: 25221423).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM18B Antibody

  • CGI-148
  • FAM18B
  • family with sequence similarity 18, member B
  • family with sequence similarity 18, member B1
  • FLJ46240
  • hypothetical protein LOC51030
  • NPD008
  • YDR084C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP1-92488
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-15012
Species: Hu
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-34174
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7276
Species: Hu
Applications: WB

Publications for FAM18B Antibody (NBP1-88090)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-88090 Applications Species
Wang AL, Rao VR, Chen JJ et al. Role of FAM18B in diabetic retinopathy. Mol Vis 2014 [PMID: 25221423] (IHC, WB, ICC/IF, Human) IHC, WB, ICC/IF Human

Reviews for FAM18B Antibody (NBP1-88090) (0)

There are no reviews for FAM18B Antibody (NBP1-88090). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM18B Antibody (NBP1-88090) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM18B Products

Bioinformatics Tool for FAM18B Antibody (NBP1-88090)

Discover related pathways, diseases and genes to FAM18B Antibody (NBP1-88090). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM18B

There are no specific blogs for FAM18B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM18B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TVP23B