TCTN3 Antibody

Images

 
Western Blot: TCTN3 Antibody [NBP1-59741] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry: TCTN3 Antibody [NBP1-59741] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Plasma membrane and cytoplasm in hepatocytes Primary Antibody Concentration: N/A Other ...read more
Western Blot: TCTN3 Antibody [NBP1-59741] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCTN3 Antibody Summary

Immunogen
Synthetic peptides corresponding to TCTN3(tectonic family member 3) The peptide sequence was selected from the middle region of TCTN3. Peptide sequence LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCTN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against TCTN3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TCTN3 Antibody

  • C10orf61
  • chromosome 10 open reading frame 61
  • DKFZP564D116
  • TECT3DKFZp564D116
  • tectonic 3
  • tectonic family member 3
  • tectonic-3

Background

TCTN3 may be involved in apoptosis regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP1-77182
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-88392
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56115
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-59741
Species: Hu
Applications: WB, IHC

Publications for TCTN3 Antibody (NBP1-59741) (0)

There are no publications for TCTN3 Antibody (NBP1-59741).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCTN3 Antibody (NBP1-59741) (0)

There are no reviews for TCTN3 Antibody (NBP1-59741). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCTN3 Antibody (NBP1-59741) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCTN3 Products

Bioinformatics Tool for TCTN3 Antibody (NBP1-59741)

Discover related pathways, diseases and genes to TCTN3 Antibody (NBP1-59741). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCTN3 Antibody (NBP1-59741)

Discover more about diseases related to TCTN3 Antibody (NBP1-59741).

Blogs on TCTN3

There are no specific blogs for TCTN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCTN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCTN3
Uniprot