Recombinant Human TBX2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TBX2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 603-702 of Human TBX2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GSARPRLRFSPYQIPVTIPPSTSLLTTGLASEGSKAAGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAANELQSIQRLVSGLESQRALSPGRESPK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TBX2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TBX2 Protein

  • FLJ10169
  • T-box 2
  • T-box protein 2
  • T-box transcription factor TBX2
  • TBX2

Background

TBX2 - T-box 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4509
Species: Hu
Applications: WB, ICC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP2-58195
Species: Hu
Applications: ICC/IF
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8124
Species: Hu
Applications: ICC
H00056996-R01
Species: Hu
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TBX2 Partial Recombinant Protein (H00006909-Q01) (0)

There are no publications for TBX2 Partial Recombinant Protein (H00006909-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBX2 Partial Recombinant Protein (H00006909-Q01) (0)

There are no reviews for TBX2 Partial Recombinant Protein (H00006909-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBX2 Partial Recombinant Protein (H00006909-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBX2 Products

Bioinformatics Tool for TBX2 Partial Recombinant Protein (H00006909-Q01)

Discover related pathways, diseases and genes to TBX2 Partial Recombinant Protein (H00006909-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBX2 Partial Recombinant Protein (H00006909-Q01)

Discover more about diseases related to TBX2 Partial Recombinant Protein (H00006909-Q01).
 

Pathways for TBX2 Partial Recombinant Protein (H00006909-Q01)

View related products by pathway.

PTMs for TBX2 Partial Recombinant Protein (H00006909-Q01)

Learn more about PTMs related to TBX2 Partial Recombinant Protein (H00006909-Q01).
 

Research Areas for TBX2 Partial Recombinant Protein (H00006909-Q01)

Find related products by research area.

Blogs on TBX2

There are no specific blogs for TBX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TBX2 Antibody
NBP1-89459

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TBX2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TBX2
Entrez