TAPT1 Antibody

Images

 
Immunohistochemistry: TAPT1 Antibody [NBP2-14522] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAPT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EEKLSNPPATCTPGKPSSKSQNKCKPSQGLSTEENLSASITKQPIHQKEN IIPLLVTSNSDQFLTTPDGDEKDITQDNSELKHRSSKKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAPT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAPT1 Protein (NBP2-14522PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAPT1 Antibody

  • CMVFR
  • TAPT1 transmembrane anterior posterior transformation 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52085
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP2-56557
Species: Hu
Applications: ICC/IF
AF1360
Species: Mu
Applications: WB, IHC
NBP1-94011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61614
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-13665
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06757
Species: Hu
NB120-13592
Species: Hu
Applications: WB
NBP2-33877
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-54918
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82913
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14630
Species: Hu
Applications: IHC, IHC-P

Publications for TAPT1 Antibody (NBP2-14522) (0)

There are no publications for TAPT1 Antibody (NBP2-14522).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAPT1 Antibody (NBP2-14522) (0)

There are no reviews for TAPT1 Antibody (NBP2-14522). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TAPT1 Antibody (NBP2-14522) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAPT1 Products

TAPT1 NBP2-14522

Bioinformatics Tool for TAPT1 Antibody (NBP2-14522)

Discover related pathways, diseases and genes to TAPT1 Antibody (NBP2-14522). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAPT1 Antibody (NBP2-14522)

Discover more about diseases related to TAPT1 Antibody (NBP2-14522).
 

Pathways for TAPT1 Antibody (NBP2-14522)

View related products by pathway.

Blogs on TAPT1

There are no specific blogs for TAPT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAPT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAPT1