Tankyrase binding protein 1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Tankyrase binding protein 1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TNKS1BP1.
  
  

  Source: E. coli

  Amino Acid Sequence: DWTPDLGLRNMAPGAVCSPGESKELGVGQMDWGNNLGLRDLEVTCDPDSGGSQGLRGCGVGQMDWTQDLAPQNVELFGAPSEARE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TNKS1BP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89826.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tankyrase binding protein 1 Recombinant Protein Antigen

• KIAA1741TAB182FLJ45975,182 kDa tankyrase-1-binding protein
• tankyrase 1 binding protein 1, 182kDa
• tankyrase 1-binding protein of 182 kDa

Background

TAB182 (tankyrase 1-binding protein of 182 kDa) was identified in a two-hybrid screen in search of tankyrase 1-interacting proteins. Tankyrase 1 is a poly (ADP-ribose) polymerase (PARP) that ribosylates the negative regulator of telomere length, TRF1 (telomere-repeat binding factor). Ribosylation of TRF1 has been shown to result in the inhibition of TRF1 binding and an induction of telomere elongation. TAB182 and TRF1 bind multiple discrete and overlapping sites of the tankyrase 1 ankyrin domain. This finding suggests that TAB182 may act as a scaffold to mediate higher order protein complex formation at telomeres. TAB182 has also been suggested to serve a role in the cytoplasm as it has been found to localize to the cytoplasmic cortical actin network.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TNKS1BP1