Recombinant Human TAF7L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TAF7L Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 231-332 of Human TAF7L partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KKRFRKTQKKVPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGFLISSGMSSHKQGHTSSEYDMLREMFSDSRSNN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TAF7L

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TAF7L Protein

  • 50kDa
  • CT40FLJ23157
  • RNA polymerase II TBP-associated factor subunit Q
  • TAF2QRNA polymerase II, Q
  • TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, Q
  • TATA box-binding protein-associated factor 50 kDa
  • transcription initiation factor TFIID subunit 7-like

Background

This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006879-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-15049
Species: Hu
Applications: WB, ICC/IF
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20830
Species: Hu
Applications: WB, ICC/IF
NBP1-84288
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-24590
Species: Mu
Applications: WB, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF5627
Species: Mu
Applications: WB
NBP1-86525
Species: Hu
Applications: IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-85448
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-30999
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TAF7L Partial Recombinant Protein (H00054457-Q01) (0)

There are no publications for TAF7L Partial Recombinant Protein (H00054457-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF7L Partial Recombinant Protein (H00054457-Q01) (0)

There are no reviews for TAF7L Partial Recombinant Protein (H00054457-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAF7L Partial Recombinant Protein (H00054457-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAF7L Products

Bioinformatics Tool for TAF7L Partial Recombinant Protein (H00054457-Q01)

Discover related pathways, diseases and genes to TAF7L Partial Recombinant Protein (H00054457-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF7L Partial Recombinant Protein (H00054457-Q01)

Discover more about diseases related to TAF7L Partial Recombinant Protein (H00054457-Q01).
 

Pathways for TAF7L Partial Recombinant Protein (H00054457-Q01)

View related products by pathway.

Blogs on TAF7L

There are no specific blogs for TAF7L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
TAF7L Antibody
NBP1-84350

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TAF7L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF7L