Recombinant Human TAF13 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TAF13 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 27-124 of Human TAF13 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS

Protein/Peptide Type
Partial Recombinant Protein
Gene
TAF13

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TAF13 Protein

  • 18kDa
  • MGC22425
  • TAF(II)18
  • TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF2K
  • TAFII18TAFII-18
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, K, 18kD
  • transcription initiation factor TFIID 18 kD subunit
  • Transcription initiation factor TFIID 18 kDa subunit
  • transcription initiation factor TFIID subunit 13

Background

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
H00006882-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-45466
Species: Hu
Applications: WB, IHC
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NBP2-41266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-21371
Species: Hu, Mu
Applications: ChIP, IP
NBP1-87006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-511
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-54974
Species: Hu
Applications: WB
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55408
Species: Hu
Applications: WB, ICC/IF

Publications for TAF13 Partial Recombinant Protein (H00006884-Q01) (0)

There are no publications for TAF13 Partial Recombinant Protein (H00006884-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF13 Partial Recombinant Protein (H00006884-Q01) (0)

There are no reviews for TAF13 Partial Recombinant Protein (H00006884-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TAF13 Partial Recombinant Protein (H00006884-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TAF13 Products

Bioinformatics Tool for TAF13 Partial Recombinant Protein (H00006884-Q01)

Discover related pathways, diseases and genes to TAF13 Partial Recombinant Protein (H00006884-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF13 Partial Recombinant Protein (H00006884-Q01)

Discover more about diseases related to TAF13 Partial Recombinant Protein (H00006884-Q01).
 

Pathways for TAF13 Partial Recombinant Protein (H00006884-Q01)

View related products by pathway.

Blogs on TAF13

There are no specific blogs for TAF13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TAF13 Antibody
NBP1-92474

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TAF13 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF13