TAAR2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit TAAR2 Antibody - BSA Free (NBP2-86840) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAAR2. Peptide sequence: ENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFFTILLDPFLNFSTPVVLF The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TAAR2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for TAAR2 Antibody - BSA Free
Background
The TAAR2 gene encodes a trace amine-associated receptor 2 protein that in is 351 amino acids long and 40 kDA in isoform 1 and is 306 amino acids long and 34 kDA in isoform 2. This receptor is known as an orphan receptor. TAAR2 participates in GPCR ligand binding, signal transduction, amine ligand-binding receptors, and neuroactive ligand-receptor interactions. It has been researched regarding its role in seizures.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: DirELISA, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow
Species: Ch, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Publications for TAAR2 Antibody (NBP2-86840) (0)
There are no publications for TAAR2 Antibody (NBP2-86840).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TAAR2 Antibody (NBP2-86840) (0)
There are no reviews for TAAR2 Antibody (NBP2-86840).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TAAR2 Antibody (NBP2-86840) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TAAR2 Products
Research Areas for TAAR2 Antibody (NBP2-86840)
Find related products by research area.
|
Blogs on TAAR2