Recombinant Human T cell receptor delta locus Protein

Images

 
SDS-Page: Recombinant Human T cell receptor delta locus Protein [H00006964-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human T cell receptor delta locus Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (CAA29800) for Human T cell receptor delta locus

Source: Wheat Germ

Amino Acid Sequence: LVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLR 173-272

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TRD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human T cell receptor delta locus Protein

  • C)
  • D
  • FLJ52034
  • FLJ52576
  • FLJ53668
  • FLJ54555
  • FLJ55265
  • FLJ56790
  • J
  • T cell receptor delta locus
  • T-cell antigen receptor, delta polypeptide
  • T-cell receptor, delta (V
  • TCRD
  • TCRDV1
  • TRD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-74080
Species: Hu
Applications: WB
H00006976-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-45883
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
NB100-56424
Species: Hu, Mu, Rt
Applications: WB
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-74190
Species: Mu
Applications: WB, ChIP
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow

Publications for T cell receptor delta locus Recombinant Protein (H00006964-Q01) (0)

There are no publications for T cell receptor delta locus Recombinant Protein (H00006964-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for T cell receptor delta locus Recombinant Protein (H00006964-Q01) (0)

There are no reviews for T cell receptor delta locus Recombinant Protein (H00006964-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for T cell receptor delta locus Recombinant Protein (H00006964-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for T cell receptor delta locus Recombinant Protein (H00006964-Q01)

Discover related pathways, diseases and genes to T cell receptor delta locus Recombinant Protein (H00006964-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for T cell receptor delta locus Recombinant Protein (H00006964-Q01)

Discover more about diseases related to T cell receptor delta locus Recombinant Protein (H00006964-Q01).
 

Pathways for T cell receptor delta locus Recombinant Protein (H00006964-Q01)

View related products by pathway.

Blogs on T cell receptor delta locus

There are no specific blogs for T cell receptor delta locus, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human T cell receptor delta locus Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRD