SUSD5 Antibody

Images

 
Immunohistochemistry: SUSD5 Antibody [NBP2-30803] - Staining of human duodenum shows membranous and cytoplasmic positivity in vessel walls.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUSD5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KHLFWFPAEAFHKPGLEKEVDDDTKKQFSAGDNHSGVKLVPGEPETKVIYGNTDGPSGPFVGKNDSKAGDPVVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUSD5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SUSD5 Protein (NBP2-30803PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUSD5 Antibody

  • sushi domain containing 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-87948
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF932
Species: Hu
Applications: WB, Simple Western, IHC, ICC
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF

Publications for SUSD5 Antibody (NBP2-30803) (0)

There are no publications for SUSD5 Antibody (NBP2-30803).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUSD5 Antibody (NBP2-30803) (0)

There are no reviews for SUSD5 Antibody (NBP2-30803). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SUSD5 Antibody (NBP2-30803) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SUSD5 Products

Bioinformatics Tool for SUSD5 Antibody (NBP2-30803)

Discover related pathways, diseases and genes to SUSD5 Antibody (NBP2-30803). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUSD5 Antibody (NBP2-30803)

Discover more about diseases related to SUSD5 Antibody (NBP2-30803).
 

Pathways for SUSD5 Antibody (NBP2-30803)

View related products by pathway.

Blogs on SUSD5

There are no specific blogs for SUSD5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUSD5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUSD5
Uniprot