Home » STK22C » STK22C Proteins » STK22C Recombinant Protein Antigen

STK22C Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for STK22C Recombinant Protein Antigen (NBP2-48674PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

STK22C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK22C.

Source: E. coli

Amino Acid Sequence: QRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMV
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TSSK3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48674.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for STK22C Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine kinase 22C (spermiogenesis associated)
  • Serine/threonine-protein kinase 22C
  • SPOGA3TSK3
  • STK22Cspermiogenesis associated 3
  • STK22D
  • Testis-specific kinase 3
  • testis-specific serine kinase 3
  • testis-specific serine/threonine kinase 22C
  • testis-specific serine/threonine-protein kinase 3
  • TSK-3
  • TSSK-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TSSK1 Antibody
(4F12)
H00083942-M01
Western Blot: TSSK1 Antibody (4F12) [H00083942-M01] - Analysis of TSSK1 expression in transfected 293T cell line by TSSK1 monoclonal antibody (M01), clone 4F12.Lane 1: TSSK1 transfected lysate(41.6 KDa).Lane 2: Non-transfected lysate.
ELISA: TSSK1 Antibody (4F12) [H00083942-M01] - Detection limit for recombinant GST tagged TSSK1 is approximately 0.03ng/ml as a capture antibody.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
TSSK2 Antibody
(1E12)
H00023617-M01
Western Blot: TSSK2 Antibody (1E12) [H00023617-M01] - TSSK2 monoclonal antibody (M01), clone 1E12 Analysis of TSSK2 expression in HL-60.
Western Blot: TSSK2 Antibody (1E12) [H00023617-M01] - Analysis of TSSK2 expression in transfected 293T cell line by TSSK2 monoclonal antibody (M01), clone 1E12.Lane 1: TSSK2 transfected lysate(41 KDa).Lane 2: Non-transfected lysate.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
TSSK6 Antibody
(6F5)
H00083983-M02
Western Blot: TSSK6 Antibody (6F5) [H00083983-M02] - TSSK6 monoclonal antibody (M02), clone 6F5 Analysis of TSSK6 expression in Hela S3 NE.
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
Cdk5 Antibody
NBP2-15843
Western Blot: Cdk5 Antibody [NBP2-15843] - Wild-type (WT) and CDK5 knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with CDK5 antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody
Immunocytochemistry/Immunofluorescence: Cdk5 Antibody [NBP2-15843] - Analysis of paraformaldehyde-fixed A549, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Cdk5 Antibody [NBP2-15843] - Rat hind brain. CDK5 antibody [C2C3], C-term dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
DMRT3 GST (N-Term) Pr ...
H00058524-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
TESK2 Antibody
(5H4)
H00010420-M04
Western Blot: TESK2 Antibody (5H4) [H00010420-M04] - Analysis of TESK2 expression in transfected 293T cell line by TESK2 monoclonal antibody (M04), clone 5H4. Lane 1: TESK2 transfected lysatE (60.3 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: TESK2 Antibody (5H4) [H00010420-M04] - Analysis of monoclonal antibody to TESK2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: TESK2 Antibody (5H4) [H00010420-M04] - Analysis of monoclonal antibody to TESK2 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 0.5 ug/ml
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
TSSK4 Antibody
NBP2-56284
Western Blot: TSSK4 Antibody [NBP2-56284] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/Immunofluorescence: TSSK4 Antibody [NBP2-56284] - Staining of human cell line HaCaT shows localization to cell junctions.
Species: Hu
Applications: WB, ICC/IF
AKR1CL2 Antibody
NBP1-90195
Western Blot: AKR1CL2 Antibody [NBP1-90195] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: AKR1CL2 Antibody [NBP1-90195] - Staining in human testis and liver tissues using anti-AKR1E2 antibody. Corresponding AKR1E2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AKR1CL2 Antibody [NBP1-90195] - Staining of human small intestine shows strong cytoplasmic positivity with granular pattern in glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
Pyruvate
Dehydrogenase Kinase ...
NB100-2383
Western Blot: PDK-1 Antibody [NB100-2383] - Analysis of HeLa lysates using NB100-2383. Image courtesy of Gregg Semenza - publication number 21620138 (PMID).
Immunocytochemistry/Immunofluorescence: PDK-1 Antibody [NB100-2383] - Antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Western Blot: PDK-1 Antibody [NB100-2383] - Detection of PDK-1 in human heart lysate using NB 100-2383 at 2 ug/ml.
(2 Reviews)
(5 Publications)
Species: Hu
Applications: WB, ICC/IF
PARP Antibody
(194C1439) - Cleaved
NB100-56599
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis of cleaved PARP in staurosporine-treated Jurkat cells at various time points, antibody at 2 ug/mL. The band corresponding to cleaved PARP is only seen in the treated samples. Anti-mouse Ig HRP conjugate was used in this test.
Immunocytochemistry/Immunofluorescence: PARP Antibody (194C1439) - Cleaved [NB100-56599] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PARP Antibody (194C1439) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PARP Antibody (194C1439) - Cleaved [NB100-56599] - Analysis using 293T lysates expressing PARP. Image from verified customer review.
(8 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
BRCA2 Antibody
NBP1-88361
Immunocytochemistry/Immunofluorescence: BRCA2 Antibody [NBP1-88361] - Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Flow Cytometry: BRCA2 Antibody [NBP1-88361] - DNA damage induced by low-dose radiation and cfDNAox and cfDNAoxR fragments activates reparation of nuclear DNA. (a) (1) Flow cytometry detection of BRCA2 in irradiated (10cGy) and control cells stained with anti-BRCA2 antibodies and secondary FITC-conjugated antibodies. Gate R encircles the fraction of MSCs with elevated values of FL1- BRCA2; (2) distribution of cells with varying BRCA2 contents. Image collected and cropped by CiteAb from the following publication (hindawi.com/journals/omcl/2017/9515809/), licensed under a CC-BY licence.
(4 Publications)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
GPR37L1 Antibody
(444532) [Unconjugate ...
MAB4449
A172 human glioblastoma cell line was stained with Mouse Anti-Human GPR37L1 Monoclonal Antibody (Catalog # MAB4449, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Species: Hu
Applications: CyTOF-ready, ICFlow
Collagen XI alpha
2 Antibody (473)
NBP2-43728
Western Blot: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - Various tissue extracts (50 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with COL11A2 antibody [473] diluted at 1:500. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - A431 cells were fixed in ice-cold MeOH for 5 min. Green: COL11A2 protein stained by COL11A2 antibody [473] diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: Collagen XI alpha 2 Antibody (473) [NBP2-43728] - Analysis of A. 30 ug 293T whole cell lysate/extract B. 30 ug whole cell lysate/extract of human COL11A2-transfected 293T cells (N-terminal fragment of COL11A2 isoform 1) 12 % SDS-PAGE COL11A2 antibody [473] dilution: 1:5000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
PNK Antibody
NBP1-87257
Western Blot: PNK Antibody [NBP1-87257] - In vitro therapeutic efficacy and in vivo pharmacodynamics. Western blotting showing the levels of each of the 6 kinases in the signature, in addition to their non-phosphorylated controls where applicable, in 10 human TNBC cell lines, the transplantable murine TNBC tumor model 4T1, and 2 patient-derived xenografts (PDXs). The three targets against which clinical-grade drugs are available are highlighted in red. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41467-018-05742-z), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: PNK Antibody [NBP1-87257] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PNK Antibody [NBP1-87257] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
(8 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD, KO
BRCA1 Antibody
(6B4)
NB100-404
Western Blot: BRCA1 Antibody (6B4) [NB100-404] - Assay was performed using MCF7 (human) and MEF(mouse embryonic fibroblast) cell lysate separated in a 5-15% gradient gel. Observed molecular weight of BRCA1: 220 KD. Predicted molecular weight of BRCA1: 220 KD. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: BRCA1 Antibody (6B4) [NB100-404] - Staining of BRCA1 nuclear foci induced by ionizing radiation. IR-treated (2 hr /4 gray IR) U2OS cells were pre-extracted with CSK buffer on ice for 4 min before fixation with 4% PFA in room temperature, and then subjected to immunostaining. DAPI was used to counterstain nucleus. 6B4 was used. Secondary antibody (Alexa Fluor-488) used for detection of primary antibody (BRCA1 antibody 6B4)
Immunohistochemistry: BRCA1 Antibody (6B4) [NB100-404]
(5 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO
PDK-1 Antibody
(SD204-9)
NBP2-67755
Western Blot: PDK-1 Antibody (SD204-9) [NBP2-67755] - Analysis of PDPK1 on different lysates using anti-PDPK1 antibody at 1/1,000 dilution. Positive control: Lane 1: 293T Lane 2: PC-12 Lane 3: HL-60
Immunocytochemistry/Immunofluorescence: PDK-1 Antibody (SD204-9) [NBP2-67755] - Staining PDPK1 in SW480 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PDK-1 Antibody (SD204-9) [NBP2-67755] - Analysis of paraffin-embedded mouse kidney tissue using anti-PDPK1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
STK4 Antibody
NBP1-31233
Western Blot: STK4 Antibody [NBP1-31233] - Wild-type (WT) and MST1 knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with STK4 antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: STK4 Antibody [NBP1-31233] - Paraformaldehyde-fixed U2OS, using STK4 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with an alpha Tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: STK4 Antibody [NBP1-31233] - Human lung adenocarcinoma. STK4 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MBP Antibody (12)
NB600-717
Western Blot: MBP Antibody (12) [NB600-717] - Mouse Brain Tissue lysate probed with Rat anti MBP.
Immunocytochemistry/Immunofluorescence: MBP Antibody (12) [NB600-717] - Histological and mRNA analysis of the inflammatory cytokines in the vehicle- or etifoxine-treated mice at onset of clinical symptoms. At day 10 p.i., drug treated animals showed significant differences in MBP staining. Animals treated with etifoxine showed an increase in retention of percentage of MBP coverage (*p = 0.001). Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/cgi/doi/10.1002/emmm.201202124), licensed under a CC-BY licence.
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse brain corpus callosum. Image from verified customer review.
(3 Reviews)
(19 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI

Publications for STK22C Recombinant Protein Antigen (NBP2-48674PEP) (0)

There are no publications for STK22C Recombinant Protein Antigen (NBP2-48674PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK22C Recombinant Protein Antigen (NBP2-48674PEP) (0)

There are no reviews for STK22C Recombinant Protein Antigen (NBP2-48674PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STK22C Recombinant Protein Antigen (NBP2-48674PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional STK22C Products

Bioinformatics Tool for STK22C Recombinant Protein Antigen (NBP2-48674PEP)

Discover related pathways, diseases and genes to STK22C Recombinant Protein Antigen (NBP2-48674PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK22C Recombinant Protein Antigen (NBP2-48674PEP)

Discover more about diseases related to STK22C Recombinant Protein Antigen (NBP2-48674PEP).
 

Pathways for STK22C Recombinant Protein Antigen (NBP2-48674PEP)

View related products by pathway.

PTMs for STK22C Recombinant Protein Antigen (NBP2-48674PEP)

Learn more about PTMs related to STK22C Recombinant Protein Antigen (NBP2-48674PEP).
 

Research Areas for STK22C Recombinant Protein Antigen (NBP2-48674PEP)

Find related products by research area.

Blogs on STK22C

There are no specific blogs for STK22C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: MBP Antibody (12) [NB600-717] - Mouse Brain Tissue lysate probed with Rat anti MBP.
MBP Antibody (12)
NB600-717

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STK22C Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TSSK3