STK22C Recombinant Protein Antigen

Images

 
There are currently no images for STK22C Recombinant Protein Antigen (NBP2-48674PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

STK22C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK22C.

Source: E. coli

Amino Acid Sequence: QRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMV

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TSSK3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48674.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for STK22C Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • serine/threonine kinase 22C (spermiogenesis associated)
  • Serine/threonine-protein kinase 22C
  • SPOGA3TSK3
  • STK22Cspermiogenesis associated 3
  • STK22D
  • Testis-specific kinase 3
  • testis-specific serine kinase 3
  • testis-specific serine/threonine kinase 22C
  • testis-specific serine/threonine-protein kinase 3
  • TSK-3
  • TSSK-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00083942-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
H00023617-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
H00083983-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010420-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-56284
Species: Hu
Applications: WB, ICC/IF
NBP1-90195
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2383
Species: Hu
Applications: WB, ICC/IF
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, Flow-IC
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
MAB4449
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-43728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-87257
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD, KO
NB100-404
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP2-67755
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI

Publications for STK22C Recombinant Protein Antigen (NBP2-48674PEP) (0)

There are no publications for STK22C Recombinant Protein Antigen (NBP2-48674PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK22C Recombinant Protein Antigen (NBP2-48674PEP) (0)

There are no reviews for STK22C Recombinant Protein Antigen (NBP2-48674PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STK22C Recombinant Protein Antigen (NBP2-48674PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional STK22C Products

Bioinformatics Tool for STK22C Recombinant Protein Antigen (NBP2-48674PEP)

Discover related pathways, diseases and genes to STK22C Recombinant Protein Antigen (NBP2-48674PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK22C Recombinant Protein Antigen (NBP2-48674PEP)

Discover more about diseases related to STK22C Recombinant Protein Antigen (NBP2-48674PEP).
 

Pathways for STK22C Recombinant Protein Antigen (NBP2-48674PEP)

View related products by pathway.

PTMs for STK22C Recombinant Protein Antigen (NBP2-48674PEP)

Learn more about PTMs related to STK22C Recombinant Protein Antigen (NBP2-48674PEP).
 

Research Areas for STK22C Recombinant Protein Antigen (NBP2-48674PEP)

Find related products by research area.

Blogs on STK22C

There are no specific blogs for STK22C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STK22C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TSSK3