ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody


Western Blot: ST3GAL2 Antibody [NBP1-69570] - This Anti-ST3GAL2 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody Summary

Synthetic peptides corresponding to ST3GAL2(ST3 beta-galactoside alpha-2,3-sialyltransferase 2) The peptide sequence was selected from the C terminal of ST3GAL2. Peptide sequence ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ST3GAL2 and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody

  • Alpha 2,3-ST 2
  • Beta-galactoside alpha-2,3-sialyltransferase 2
  • beta-galactoside alpha-2,3-sialytransferase
  • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
  • EC
  • EC
  • Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase
  • Gal-NAc6S
  • sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase)
  • Sialyltransferase 4B
  • SIAT4B
  • SIAT4-B
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 2
  • ST3GAL2
  • ST3GalA.2
  • ST3GalA.2ST3Gal II


ST3GAL2 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IP
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB

Publications for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (NBP1-69570) (0)

There are no publications for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (NBP1-69570).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (NBP1-69570) (0)

There are no reviews for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (NBP1-69570). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (NBP1-69570) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Products

Bioinformatics Tool for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (NBP1-69570)

Discover related pathways, diseases and genes to ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (NBP1-69570). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (NBP1-69570)

Discover more about diseases related to ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (NBP1-69570).

Pathways for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (NBP1-69570)

View related products by pathway.

PTMs for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (NBP1-69570)

Learn more about PTMs related to ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (NBP1-69570).

Blogs on ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2

There are no specific blogs for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody and receive a gift card or discount.


Gene Symbol ST3GAL2