ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody - BSA Free

Western Blot: ST3GAL2 Antibody [NBP1-69570] - This Anti-ST3GAL2 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ST3GAL2(ST3 beta-galactoside alpha-2,3-sialyltransferase 2) The peptide sequence was selected from the C terminal of ST3GAL2. Peptide sequence ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ST3GAL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody - BSA Free

• Alpha 2,3-ST 2
• Beta-galactoside alpha-2,3-sialyltransferase 2
• beta-galactoside alpha-2,3-sialytransferase
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
• EC 2.4.99.4
• EC 2.4.99.7
• Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase
• Gal-NAc6S
• sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase)
• Sialyltransferase 4B
• SIAT4B
• SIAT4-B
• ST3 beta-galactoside alpha-2,3-sialyltransferase 2
• ST3GAL2
• ST3GalA.2
• ST3GalA.2ST3Gal II
• ST3GALII

Background

ST3GAL2 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ST3GAL2
• Uniprot:
  • Q16842(Human)