Home » ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 » ST3GAL2 Antibodies » ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody

ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody [H00006483-B01P] - Analysis of ST3GAL2 expression in transfected 293T cell line by ST3GAL2 polyclonal antibody. Lane 1: ST3GAL2 transfected lysate(38.5 KDa). Lane 2: Non-transfected lysate.
Western Blot: ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody [H00006483-B01P] - Analysis of ST3GAL2 expression in transfected 293T cell line by ST3GAL2 polyclonal antibody. Lane 1: ST3GAL2 transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody Summary

Immunogen
ST3GAL2 (NP_008858.1, 1 a.a. - 350 a.a.) full-length human protein. MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
Specificity
ST3GAL2 - ST3 beta-galactoside alpha-2,3-sialyltransferase 2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ST3GAL2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody

  • Alpha 2,3-ST 2
  • Beta-galactoside alpha-2,3-sialyltransferase 2
  • beta-galactoside alpha-2,3-sialytransferase
  • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
  • EC 2.4.99.4
  • EC 2.4.99.7
  • Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase
  • Gal-NAc6S
  • sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase)
  • Sialyltransferase 4B
  • SIAT4B
  • SIAT4-B
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 2
  • ST3GAL2
  • ST3GalA.2
  • ST3GalA.2ST3Gal II
  • ST3GALII

Background

The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ST3GAL3 Antibody
NBP2-20491
Western Blot: ST3GAL3 Antibody [NBP2-20491] - Sample (30 ug of whole cell lysate) A: NT2D1 B: IMR32 10% SDS PAGE gel, diluted at 1:5000.
Immunocytochemistry/Immunofluorescence: ST3GAL3 Antibody [NBP2-20491] - Analysis of methanol-fixed MCF-7, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: ST3GAL3 Antibody [NBP2-20491] - Immunohistochemical analysis of paraffin-embedded Adrenal Gland Tumor, using antibody at 1:250 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ST3 beta-Gal
alpha-2,3-Sialyltrans ...
AF6905
Western blot shows lysates of human placenta. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human ST3 beta -Gal alpha -2,3-Sialyltransferase 1/ST3GAL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6905) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for ST3 beta -Gal alpha -2,3-Sialyltransferase 1/ST3GAL1 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
ST6 Gal
Sialyltransferase 1/S ...
AF5924
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Human ST6GAL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5924) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for ST6GAL1 at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Simple Western lane view shows lysates of Daudi human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for ST6 Gal Sialyltransferase 1/ST6GAL1 at approximately 64 kDa (as indicated) using 10 µg/mL of Goat Anti-Human ST6 Gal Sialyltransferase 1/ST6GAL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5924) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(1 Review)
(9 Publications)
Species: Hu
Applications: WB, Simple Western
ST3GAL4 Antibody
NBP1-69565
Western Blot: ST3GAL4 Antibody [NBP1-69565] - This Anti-ST3GAL4 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.25ug/ml.
Immunohistochemistry: ST3GAL4 Antibody [NBP1-69565] - Human Liver cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Carbohydrate
Sulfotransferase 1/CH ...
AF5316
Western blot shows lysates of human tonsil tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Carbohydrate Sulfotransferase 1/CHST1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5316) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Carbohydrate Sulfotransferase 1/CHST1 at approximately 48 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
SSEA-1 Antibody
(MC-480)
NB100-1831
Immunocytochemistry/Immunofluorescence: SSEA-1 Antibody (MC-480) [NB100-1831] - SSEA1 antibody (0.1ug/ml) was tested in Ntera2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40x.
Flow Cytometry: SSEA-1 Antibody (MC-480) [NB100-1831] - An intracellular stain was performed on Jurkat cells with SSEA-1 Antibody (MC-480)NB100-1831 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by mouse IgM Alexa Fluor 488-conjugated secondary antibody.
Immunocytochemistry/Immunofluorescence: SSEA-1 Antibody (MC-480) [NB100-1831] - SSEA1 antibody was tested in Ntera-2 cells with FITC (green). Nuclei and alpha-tubulin were counterstained with Dapi (blue) and Dylight 550 (red).
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
RelB Antibody
(315206) [Unconjugate
MAB2698
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line and Raji human Burkitt's lymphoma cell line. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human RelB Monoclonal Antibody (Catalog # MAB2698) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for RelB at approximately 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
RelB was detected in immersion fixed Raji human Burkitt's lymphoma cell line using Mouse Anti-Human RelB Monoclonal Antibody (Catalog # MAB2698) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
RelB was detected in immersion fixed paraffin-embedded sections of human lymphoma using 8 µg/mL Mouse Anti-Human RelB Monoclonal Antibody (Catalog # MAB2698) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm in epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC, ICC
RGS14 Antibody
NBP2-20148
Western Blot: RGS14 Antibody [NBP2-20148] - Sample (30 ug of whole cell lysate) A: Jurkat 7. 5% SDS PAGE gel, diluted at 1:2000.
Immunohistochemistry-Paraffin: RGS14 Antibody [NBP2-20148] - Paraffin-embedded mouse testis. RGS14 antibody [N1N3] dilution: 1:500.
Immunohistochemistry-Paraffin: RGS14 Antibody [NBP2-20148] - Immunohistochemical analysis of paraffin-embedded HBL435 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: WB, IHC, IHC-P
BTG2 Antibody
NBP1-81215
Western Blot: BTG2 Antibody [NBP1-81215] - Analysis in control (vector only transfected HEK293T lysate) and bTG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: BTG2 Antibody [NBP1-81215] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: BTG2 Antibody [NBP1-81215] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
FE65 Antibody
NB110-58360
Western Blot: FE65 Antibody [NB110-58360] - Cells were transfected with the pCMV6-ENTRY control or pCMV6-ENTRY APBB1 cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-APBB1.
Western Blot: FE65 Antibody [NB110-58360] - Protein on HEK 293 cell lysate.
Species: Hu, Mu, Rt
Applications: WB, IP
TATA binding
protein TBP Antibody
NBP2-12933
Western Blot: TATA binding protein TBP Antibody [NBP2-12933] - Staining of Pig Testis lysate (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence
Western Blot: TATA binding protein TBP Antibody [NBP2-12933] - NBP2-12933 (1ug/ml) staining of HeLa nuclear (A) and cytosolic (B) lysates (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Western Blot: TATA binding protein TBP Antibody [NBP2-12933] - Analysis of cell line NIH3T3 (A), Mouse Testis (B) and Rat Testis (C) lysates (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
PC1/3 Antibody
(3D2)
H00005122-M02
Western Blot: PC1/3 Antibody (3D2) [H00005122-M02] - PCSK1 monoclonal antibody (M02), clone 3D2. Analysis of PCSK1 expression in Raw 264.7.
Immunocytochemistry/Immunofluorescence: PC1/3 Antibody (3D2) [H00005122-M02] - Analysis of monoclonal antibody to PCSK1 on HeLa cell. Antibody concentration 30 ug/ml.
Immunohistochemistry-Paraffin: PC1/3 Antibody (3D2) [H00005122-M02] - Analysis of monoclonal antibody to PCSK1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
E-Selectin/CD62E
Antibody (BBIG-E4) [U ...
BBA16
E-Selectin/CD62E was detected in immersion fixed HUVEC human umbilical vein endothelial cells activated with TNF‑ alpha (Catalog # 210-TA-010) using Mouse Anti-Human E‑Selectin/CD62E Monoclonal Antibody (Catalog # BBA16) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
E‑Selectin/CD62E was detected in immersion fixed paraffin-embedded sections of human brain (occipital cortex) using 10 µg/mL Mouse Anti-Human E‑Selectin/CD62E Monoclonal Antibody (Catalog # BBA16) overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(31 Publications)
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)

N-Acetylgalactosamine- ...
NBP1-32899
Western Blot: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - Sample (30 ug of whole cell lysate) A: H1299 7.5% SDS PAGE diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - Paraformaldehyde-fixed HeLa, using GALNS antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled Red.
Immunohistochemistry-Paraffin: N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody [NBP1-32899] - Paraffin-embedded NCI-N87 xenograft, using antibody at 1:100 dilution.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Cbx8 Antibody
NBP1-83224
Western Blot: Cbx8 Antibody [NBP1-83224] - Analysis in human cell line A-549.
Immunocytochemistry/Immunofluorescence: Cbx8 Antibody [NBP1-83224] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Cbx8 Antibody [NBP1-83224] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ACTR1B Antibody
NBP2-15275
Western Blot: ACTR1B Antibody [NBP2-15275] - Sample (30 ug of whole cell lysate) A: IMR32 10% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: ACTR1B Antibody [NBP2-15275] - SKNSH cells were fixed in ice-cold MeOH for 5 min. Green: ACTR1B protein stained by ACTR1B antibody diluted at 1:1000. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: ACTR1B Antibody [NBP2-15275] - Paraffin-embedded ovarian carcinoma. ACTR1B antibody dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
BMPR-II Antibody
AF811
PC‑3 human prostate cancer cell line was stained with Goat Anti-Human BMPR‑II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF811, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
BMPR-II was detected in formalin fixed paraffin-embedded sections of human prostate using Goat Anti-Human BMPR-II Antigen Affinity-purified Polyclonal Antibody (Catalog # AF811) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the plasma membrane of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(7 Publications)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
ST3 beta-Gal
alpha-2,3-Sialyltrans ...
H00006483-B01P
ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody
Species: Hu
Applications: WB

Publications for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P) (0)

There are no publications for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P) (0)

There are no reviews for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Products

Bioinformatics Tool for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P)

Discover related pathways, diseases and genes to ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P)

Discover more about diseases related to ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P).
 

Pathways for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P)

View related products by pathway.

PTMs for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P)

Learn more about PTMs related to ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P).

Blogs on ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2

There are no specific blogs for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ST3GAL2
Entrez
Uniprot