ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody

Images

 
Western Blot: ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody [H00006483-B01P] - Analysis of ST3GAL2 expression in transfected 293T cell line by ST3GAL2 polyclonal antibody. Lane 1: ST3GAL2 transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody Summary

Immunogen
ST3GAL2 (NP_008858.1, 1 a.a. - 350 a.a.) full-length human protein. MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN
Specificity
ST3GAL2 - ST3 beta-galactoside alpha-2,3-sialyltransferase 2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ST3GAL2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody

  • Alpha 2,3-ST 2
  • Beta-galactoside alpha-2,3-sialyltransferase 2
  • beta-galactoside alpha-2,3-sialytransferase
  • CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
  • EC 2.4.99.4
  • EC 2.4.99.7
  • Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase
  • Gal-NAc6S
  • sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase)
  • Sialyltransferase 4B
  • SIAT4B
  • SIAT4-B
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 2
  • ST3GAL2
  • ST3GalA.2
  • ST3GalA.2ST3Gal II
  • ST3GALII

Background

The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20491
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31449
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5924
Species: Hu
Applications: WB, Simple Western
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
AF5316
Species: Hu
Applications: WB
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2698
Species: Hu
Applications: WB, IHC, ICC
NBP2-20148
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58360
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
H00006483-B01P
Species: Hu
Applications: WB

Publications for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P) (0)

There are no publications for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P) (0)

There are no reviews for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Products

Bioinformatics Tool for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P)

Discover related pathways, diseases and genes to ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P)

Discover more about diseases related to ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P).
 

Pathways for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P)

View related products by pathway.

PTMs for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P)

Learn more about PTMs related to ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody (H00006483-B01P).

Blogs on ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2

There are no specific blogs for ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST3 beta-Gal alpha-2,3-Sialyltransferase 2/ST3GAL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST3GAL2
Entrez
Uniprot