SSX4 Antibody (3E10.)

Images

 
Western Blot: SSX4 Antibody (3E10) [H00006759-M02] - Western Blot detection against Immunogen (36.52 KDa).
Immunocytochemistry/ Immunofluorescence: SSX4 Antibody (3E10) [H00006759-M02] - Analysis of monoclonal antibody to SSX4 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: SSX4 Antibody (3E10) [H00006759-M02] - Detection limit for recombinant GST tagged SSX4 is approximately 3ng/ml as a capture antibody.
Sandwich ELISA: SSX4 Antibody (3E10) [H00006759-M02] - Detection limit for recombinant GST tagged SSX4 is 0.03 ng/ml as a capture antibody.
Sandwich ELISA: SSX4 Antibody (3E10) [H00006759-M02] - Detection limit for recombinant GST tagged SSX4 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SSX4 Antibody (3E10.) Summary

Immunogen
SSX4 (NP_005627, 91 a.a. - 188 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE
Specificity
SSX4 - synovial sarcoma, X breakpoint 4
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SSX4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SSX4 Antibody (3E10.)

  • Cancer/testis antigen 5.4
  • CT5.4SSX4B
  • MGC119056
  • MGC12411
  • protein SSX4
  • SSX4A
  • synovial sarcoma, X breakpoint 4

Background

The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4, represents the more telomeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48008
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-65206
Species: Hu
NBP2-00614
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-89370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01842
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-34145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-85397
Species: Hu
Applications: IHC, IHC-P
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NBP1-80294
Species: Hu
Applications: WB
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-45719
Species: Hu
Applications: WB, IHC
H00117177-B01P
Species: Hu, Ze
Applications: WB, ChIP, ELISA

Publications for SSX4 Antibody (H00006759-M02) (0)

There are no publications for SSX4 Antibody (H00006759-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSX4 Antibody (H00006759-M02) (0)

There are no reviews for SSX4 Antibody (H00006759-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SSX4 Antibody (H00006759-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SSX4 Products

Bioinformatics Tool for SSX4 Antibody (H00006759-M02)

Discover related pathways, diseases and genes to SSX4 Antibody (H00006759-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSX4 Antibody (H00006759-M02)

Discover more about diseases related to SSX4 Antibody (H00006759-M02).
 

Pathways for SSX4 Antibody (H00006759-M02)

View related products by pathway.

PTMs for SSX4 Antibody (H00006759-M02)

Learn more about PTMs related to SSX4 Antibody (H00006759-M02).
 

Research Areas for SSX4 Antibody (H00006759-M02)

Find related products by research area.

Blogs on SSX4

There are no specific blogs for SSX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SSX4 Antibody (3E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol SSX4
Entrez
OMIM
Uniprot